KEGG   Actinoalloteichus hymeniacidonis: TL08_20775Help
Entry
TL08_20775        CDS       T04472                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
ahm  Actinoalloteichus hymeniacidonis
Pathway
ahm00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ahm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    TL08_20775
Enzymes [BR:ahm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TL08_20775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14 DUF4434 DUF4350 Cellulase DUF3459
Motif
Other DBs
NCBI-ProteinID: AOS64946
UniProt: A0A1D8C1M0
LinkDB All DBs
Position
complement(4905706..4907754)
Genome map
AA seq 682 aa AA seqDB search
MGKDLTALRSRLGGPAYGCDYNPEQWPEEVWAEDMRLMRQAGVNLVSVGIFSWAKIEPRP
GEYDFGWFDRLMDLLAANGIGACLATMTASPPPWLARLHPETLPITATGVRLAPGSRQQF
CPSSPVYRDHARRLVEQIATRYRDHPALALWHVNNEYGCHMNACYCEVSAAAFREWLRDR
YGDLATLNAAWYTDFWSQQYGEWDEIGVPSLAPYHPNPTQSIDFSRFTSDAFLGCFRTEK
EVLSRLTPEVPVTTNFIHEGPAIDLFGWAEDQDLIAFDSYPDPFEADSHIAAGFHYDLMR
SLRHGQPWFLMEQATAAVNWRERNAMKAPGAMRLGSWQAVAQGADAVMFFQWRASRGGTE
KFHAAMVPHTGTDTRIFREVCELGAELAAVPGLVDSRVHADTALLLDWSSWWALERDSHP
SVDVTRGEAELAHYAPLFEAGVTCDVVHPERDLSGYRLVVVPNLYLMTESVAERLLAYVR
GGGHLVVSFFSGIVDENDHIHPGGMAPALRETLGVWVEEFWALPEAGTVAVTGLAGSDST
GTGRIWSEVIRLEGAQSLAEFAEGELVGSPAVTRHQLDSGVAWYLGTRLDAATMRGLLDR
VRGEAGVAPDLAVPPGVQAVTRHAEDGTRFLLLLNHGDEPAEITLDQPMVDLLAGVTEPD
RESSTAIRLGSRGVAVLTAATD
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggatctgaccgcgctgcggagcaggctcggcggccccgcctacggctgcgac
tacaacccggagcaatggcccgaggaggtctgggccgaggacatgcggttgatgcgccag
gccggggtcaacctggtcagcgtcggcatcttctcgtgggcgaagatcgaaccccgtccc
ggcgagtacgacttcggctggttcgaccggttgatggacctcttggccgccaacggcatc
ggggcgtgcctggccaccatgaccgcctcgccgccgccatggctggcccggttgcatccc
gagacactgccgatcaccgcgaccggggttcggttggctccaggttcacggcagcagttc
tgtccgtcgagcccggtgtaccgcgaccacgcgcgccggctggtggagcagatcgccacc
cgctaccgggaccatccggccttggcgttgtggcacgtcaacaacgagtacggctgccat
atgaacgcctgttactgcgaggtctcggcggccgcgttccgcgaatggctccgggaccgt
tacggcgatctggccacgctgaacgccgcctggtacaccgatttctggtcgcagcagtac
ggtgagtgggacgagatcggggtgccgagcctggcgccgtaccacccgaacccgacgcag
agcattgatttctcgcgcttcacctcggatgccttcctcggctgcttccgcaccgagaag
gaggtgctgtcccggctgacccccgaggtcccggtgaccaccaacttcatccacgaggga
ccggccatcgacctgttcggttgggccgaggaccaggacctcatcgccttcgattcctac
cccgaccccttcgaggccgacagccacatcgccgccggtttccactatgacctgatgcgc
tccctgcggcacggtcagccgtggtttctgatggagcaggccacggcggcggtgaactgg
cgggagcgcaacgccatgaaggcgccgggcgcgatgcggctgggcagctggcaggccgtc
gcgcagggcgccgacgcggtgatgttcttccaatggcgggcttcccggggcggcaccgag
aagttccacgcggcgatggttccgcacaccggaaccgacacccggatcttccgcgaggtg
tgcgaactcggtgccgagctcgcggcggtgcccggattggtcgacagccgggtgcacgcc
gacacggcgctgctgttggactggtcgagttggtgggccctggaacgcgattcgcatccg
agtgtcgacgtgacccgcggcgaggcggagctggcgcactacgccccgctgttcgaggcc
ggggtgacctgcgacgtcgtgcatccggagcgggatctgtccggctaccggctggtggtc
gtgccgaacctgtatctgatgacggaatcggttgctgagcgcttgcttgcatatgtgcgg
ggcggcgggcacctggtggtgtccttcttctccggcatcgtcgacgagaacgaccacatc
catccaggtgggatggccccggccctgcgcgagaccttgggagtctgggtcgaggagttc
tgggccctgcccgaggcgggaaccgtggccgtgaccggattggcgggcagcgattccacc
ggcaccgggcggatctggtcggaggtgatccggctggagggcgcgcagtcgctggccgag
ttcgccgagggcgagttggtcggttcgcccgcagtcacccgccaccaactggattcgggt
gtcgcctggtacctgggtacgcgcttggatgccgccacgatgcgcggcctcctcgatcgg
gtgcgcggcgaggccggggtcgcccccgacctggcggtgccgcccggtgtccaggcggtc
acccgacatgccgaggacggcactcgtttcctgttgctgctcaaccatggcgacgaaccg
gcggagatcaccctcgaccagccgatggtcgacctactggccggtgtaaccgagcccgac
cgcgaatcctccacagcgatccggctgggtagccgcggggtagcggtgctgaccgccgcg
acggattga

DBGET integrated database retrieval system