KEGG   Actinoalloteichus hymeniacidonis: TL08_24485Help
Entry
TL08_24485        CDS       T04472                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ahm  Actinoalloteichus hymeniacidonis
Pathway
ahm00020  Citrate cycle (TCA cycle)
ahm00480  Glutathione metabolism
ahm01100  Metabolic pathways
ahm01110  Biosynthesis of secondary metabolites
ahm01120  Microbial metabolism in diverse environments
ahm01130  Biosynthesis of antibiotics
ahm01200  Carbon metabolism
ahm01210  2-Oxocarboxylic acid metabolism
ahm01230  Biosynthesis of amino acids
Module
ahm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ahm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ahm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TL08_24485
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TL08_24485
Enzymes [BR:ahm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     TL08_24485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AOS65675
UniProt: A0A1D8C3P9
LinkDB All DBs
Position
complement(5719972..5721189)
Genome map
AA seq 405 aa AA seqDB search
MGKIKVQGKVVELDGDEMTRIIWQFIKDRLVHPYLDVDLEYYDLGIESRDATDDQITVDA
ANAIAKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIIENIPRL
VPGWTKPIIIGRHAHGDQYKASDFKVPGPGTVTISYTPADGSEPMELEVAQFPEGGGVAI
GMYNYRKSIEDFARASLAYGLQRGYPVYMSTKNTILKAYDGMFKDVFEEIFEKEFKAEFD
KQGLTYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
RTVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIFAWSRGLAHRGKLDQTREVIEFAHTLE
RVVIETVESGKMTKDLAVLVGKDQGFQTTEEFLASLDENLAKKLG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcaaggtacagggcaaggtcgtcgaactcgacggcgacgagatgaccagg
atcatctggcagttcatcaaggaccggctggtccacccctatctcgatgtcgacctcgag
tactacgacctcggcatcgagagccgcgacgccacggacgaccagatcaccgtcgacgcg
gcgaacgcgatcgccaagcacggagtgggcgtcaagtgcgccaccatcaccccggacgag
gccagggtcgaggagttcggcctcaagaagatgtggcggagcccgaacgggaccatccgc
aacatcctcggcggtgtcgtcttccgtgagccgatcatcatcgagaacatcccccggctg
gtgcccggctggaccaagccgatcatcatcggcaggcacgcgcacggcgaccagtacaag
gccagcgacttcaaggtccccggccccggcaccgtgaccatcagctacacgcctgccgac
ggcagcgagccgatggagctggaggtcgcgcagttccccgagggcggcggcgtcgccatc
ggtatgtacaactaccgcaagtcgatcgaggacttcgcgcgcgcctcgctggcctacggt
ctgcagcgtggctacccggtctacatgtcgaccaagaacaccatcctcaaggcctacgac
ggcatgttcaaggacgtgttcgaggagatcttcgagaaggagttcaaggccgagttcgac
aagcaggggctcacctacgagcaccggctcatcgacgacatggtggcctctgcactcaag
tgggagggcggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacacc
gtggcgcagggcttcggctcgctgggcctgatgacctccgtgctgatgaccccggacggc
cgcacggtcgaggccgaggccgcgcacggcacggtcacccggcactaccgccagcaccag
gcgggcaagccgacctccaccaacccgatcgcctcgatcttcgcctggagccgaggattg
gcgcaccggggcaagctcgaccagacccgcgaggtcatcgagttcgcgcacaccctggag
cgggtcgtcatcgagaccgtcgagagcggcaagatgaccaaggacctcgccgtgctggtc
ggcaaggaccagggcttccagaccaccgaggagttcctcgcgagcctggacgagaacctg
gcgaagaagctgggctga

DBGET integrated database retrieval system