KEGG   Atlantibacter hermannii: NCTC12129_00941Help
Entry
NCTC12129_00941   CDS       T05790                                 

Gene name
mrcB
Definition
(GenBank) penicillin-binding protein 1B [includes: penicillin-insensitive transglycosylase; penicillin sensitive transpeptidase]
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
ahn  Atlantibacter hermannii
Pathway
ahn00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ahn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NCTC12129_00941 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ahn01003]
    NCTC12129_00941 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ahn01011]
    NCTC12129_00941 (mrcB)
Enzymes [BR:ahn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     NCTC12129_00941 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NCTC12129_00941 (mrcB)
Glycosyltransferases [BR:ahn01003]
 Polysaccharide
  Bacterial polysaccharide
   NCTC12129_00941 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:ahn01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   NCTC12129_00941 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H PBP1_TM Transpeptidase UvrB_inter DUF3484
Motif
Other DBs
NCBI-ProteinID: VDZ71868
UniProt: A0A447LJF7
LinkDB All DBs
Position
1:859937..862456
Genome map
AA seq 839 aa AA seqDB search
MAGNDREPIGRKGKPSRPVKQKVTRRRLREDEYDDDYEDDDNEEPMPPRKGKGKKPQRKR
RWLWLLLKLMLVLIVVLVIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMPVSKQE
MVQLLEATQYRKVTRMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFSKDRLETI
ENLDSKRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGYPDLLVDTLIATEDRHFYEHDGI
SLYSIGRAVLANLTAGRAVQGASTLTQQLAKNLFLSSERTLWRKANEAYMALIMDARYSK
DRILELYLNEVYLGQSGDNEIRGFPLASLYYFGRPVDELSLDQQALLVGMVKGASIYNPW
RNPKMALERRNLVLRLLQEQKVIDQELYDMLSARPLGVQPRGGVISPQPAFMQMVRQELQ
AKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGIPALIKQRKLSDLETAMVVVDRFSGE
VRAMVGGANPQFAGYNRAMQARRSIGSLAKPATYLTALSQPNQYRLNTWIADAPISLRQP
NGQVWSPQNDDHRYSGQVMLVDALTRSMNVPTVNLGMAIGLPAVTDTWLKLGVPKDQLHP
VPSMLLGALNLTPIEVAQAFQTIASGGNRATLSAVRSVIAEDGTPLFQSFPQSERAVPAQ
AAYMTLWTMQQVVQRGTGRQLGAKFPGLHLAGKTGTTNNQVDTWFAGIDGREVVITWVGR
DNNQPTKLYGASGAMSIYQRYLSNQSPIGLDLTPPEDIVDMSVDDQGYFICGGGGTRTLP
VWTTNPDALCQQSRPVEPSGNPFEQSSPPQQQQPQQQQQAPAQEQKSDGVAGWIKDMFG
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaatgaccgcgaacccatcgggcgtaaagggaaaccttcccgtccggtgaaa
cagaaagtaacccgtcgtcgtctcagagaagatgagtacgacgatgactacgaagatgat
gacaatgaggaaccgatgccaccacggaaaggcaaagggaaaaaaccgcagcgcaaacgc
cgctggctttggctgttgctgaaactgatgctggtgctgatcgtcgtgctggtgatttac
ggcgtgtacctcgatcagaaaatccgcagccgtatcgacggtaaagtctggcaactgccc
gccgccgtctatggccggatggttaaccttgaaccggatatgccggtcagtaagcaagaa
atggtgcaactgctggaagcgacgcagtaccgcaaggtgacgcgcatgacgcgccccggc
gaattcaccgttcaggccaacagcattgaaatgatccgccgcccgttcgacttcccggac
agtaaagaagggcaggtgcgcgcgcgtctgacgttcagcaaagatcgtcttgagaccatt
gagaatctcgacagcaagcgccagtttggcttcttccgcctcgatccgcgtttgattacc
atgctttcatcgccgaacggcgagcagcgtctgtttgtgccgcgtagcggctatccggat
ctgctggtggatacgctgatcgctaccgaagaccgtcatttctatgagcatgacgggatt
agcctctattccattggccgtgcggtgctggcgaacctgacggccggacgcgctgttcag
ggcgcgagtaccctgacgcagcagctggcgaaaaacctgttcctgtcgagtgaacgtacg
ctgtggcgtaaggcgaatgaagcgtacatggcgctgatcatggatgcgcgctacagcaaa
gaccgcattcttgaactctatctgaacgaagtgtatctcggtcagagtggcgataacgaa
atccgcggcttcccgctggccagcctgtactactttggccgcccggtggacgagctgagc
ctcgaccagcaggcgttgctggtggggatggtaaaaggcgcgtcgatttataacccgtgg
cgtaacccgaaaatggcgctggagcgccgtaatctggtgctgcgtctgttgcaggaacag
aaggttatcgatcaggagctgtatgacatgctgagtgcgcgtccgctgggcgtgcagccg
cgcggcggggtgatttctccgcagccagcctttatgcagatggtgcgccaggaactgcag
gcgaagctgggcgataaagtgaaagatctctccggcgtgaagatcttcaccacttttgat
tccgtggcgcaggatgcggcggaaaaagccgcggtcgaaggcattccggcattaatcaag
cagcgcaaactgagtgatctggaaacggcgatggtggtcgtggaccgtttcagcggcgaa
gtccgtgcgatggttggcggggcgaatccgcaatttgccggttataaccgcgccatgcag
gcacgccgttctatcggctcgctggcgaaaccggcgacctatctgacggcgctgagccag
ccgaaccagtaccgcctgaatacctggattgccgatgcgccgatttcactgcgccagccg
aatggccaggtgtggtcgccgcagaacgatgatcatcgttacagcggccaggtgatgctg
gtggatgcgttaacccgttccatgaacgtgccgacggtgaatctggggatggcgattggc
ctgcctgcggtaactgacacctggctgaagctgggcgtgccgaaagatcagctgcaccct
gttccttccatgctgctgggcgcgctgaacctgacgccgattgaagtcgctcaggcgttc
cagaccatcgccagcggcggcaaccgcgccacgctgtcagcggtgcgttcggtcattgct
gaagacgggaccccgctgttccagagcttcccgcagtcggaacgcgccgtacccgcgcag
gcggcgtatatgacgctgtggaccatgcaacaggtcgtgcagcgcggcaccggtcgccaa
ctgggcgcgaagttcccgggcctgcatctggcgggtaaaaccgggaccaccaacaatcag
gtggatacctggtttgccggtatcgatggccgtgaagtggtaatcacctgggtaggacgc
gacaacaaccagccgacgaagctgtatggcgcgagcggcgcgatgtcgatttaccagcgt
tacctcagcaaccagtcgccaatcgggctggacctgacgccgccggaagacattgttgat
atgagcgttgatgaccagggttacttcatctgcggtggcggtggcacgcgtacacttccg
gtgtggaccaccaacccggatgcgctttgccagcagagccgcccggttgagccgtcgggg
aatccgttcgagcagtcttcgccgccgcaacagcagcagcctcagcaacagcaacaagcg
cctgcgcaggagcaaaaaagcgatggcgtagcgggctggatcaaggacatgttcggctaa

DBGET integrated database retrieval system