KEGG   Atlantibacter hermannii: NCTC12129_00976Help
Entry
NCTC12129_00976   CDS       T05790                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ahn  Atlantibacter hermannii
Pathway
ahn00061  Fatty acid biosynthesis
ahn00780  Biotin metabolism
ahn01100  Metabolic pathways
ahn01212  Fatty acid metabolism
Module
ahn_M00083  Fatty acid biosynthesis, elongation
ahn_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ahn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NCTC12129_00976 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NCTC12129_00976 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ahn01004]
    NCTC12129_00976 (fabZ)
Enzymes [BR:ahn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     NCTC12129_00976 (fabZ)
Lipid biosynthesis proteins [BR:ahn01004]
 Fatty acid synthase
  Component type
   NCTC12129_00976 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: VDZ71902
UniProt: A0A447LJJ0
LinkDB All DBs
Position
1:897922..898377
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLHIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVTVNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSRES
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatacgctgcacatcgaagagatcttagaacttctgccgcaccgt
ttccccttcttactggtggaccgcgtgctggactttgaagagggtcgcttcctgcgagca
gtaaaaaacgttacggtaaacgaaccgtttttccagggccacttccctggtaaaccgatt
ttcccaggggtgctgattctggaagcgatggcgcaggccaccggtattctggcgttcaaa
agcgtgggtaaactggaaccgggtgagctttactattttgcaggcatcgatgaagcacgc
ttcaagcgtccggtagtaccgggcgaccaaatgattatggaagtcacttttgagaaaacc
cgccgtggcctgacgcgctttaaaggcgtggcactggtcgatggcaaagttgtctgcgaa
gctaccatgatgtgtgcgcgcagcagggagtcctga

DBGET integrated database retrieval system