KEGG   Atlantibacter hermannii: NCTC12129_01163Help
Entry
NCTC12129_01163   CDS       T05790                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ahn  Atlantibacter hermannii
Pathway
ahn00473  D-Alanine metabolism
ahn00550  Peptidoglycan biosynthesis
ahn01100  Metabolic pathways
ahn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ahn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NCTC12129_01163 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NCTC12129_01163 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    NCTC12129_01163 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ahn01011]
    NCTC12129_01163 (ddlA)
Enzymes [BR:ahn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NCTC12129_01163 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:ahn01011]
 Precursor biosynthesis
  Amino acid ligase
   NCTC12129_01163 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATPgrasp_ST CPSase_L_D2 ATP-grasp_4 RimK
Motif
Other DBs
NCBI-ProteinID: VDZ72079
UniProt: A0A447LK51
LinkDB All DBs
Position
1:complement(1076563..1077663)
Genome map
AA seq 366 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKEKFDVVLMGIDKQGEWHINDASGYLLN
ASDPARIALNRSEKTLALIPGQTEQQLIETHSHASLPQVDVIFPIVHGTLGEDGSLQGLL
RMANLPFVGSGVLGSAVSMDKDIAKRLLRDAGLAVAPFITLTRVNRSQYSFEDVVTKLGV
PMFIKPANQGSSVGVSKVTTAGEYQTAVELAFEFDHKVVVETGIVGREIECAVLGNDRPE
ASTCGEIVVNSAFYSYDTKYIDGDAARVDVPANIAPEINDKIRAIAIRAYQALECSGMAR
VDVFLTPENEVIINEINTLPGFTNISMYPKLWQASGMSYQQLITRLIELALERHAQDSAL
KSTITP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactgcgggtagggattgtgtttggcggtaaatcagccgagcacgaagtatca
cttcagtcagcgaaaaacatcgtcgacgccattgataaagagaaatttgacgtggtgctg
atggggattgataaacagggcgaatggcatattaacgatgccagcggctatctgctcaat
gccagtgaccctgcgcgtattgccctgaatcgctctgaaaaaacgctggcgctgatcccc
ggccagacggaacaacagctgatcgaaacccacagccacgcaagcctgcctcaggtcgac
gtcattttccccatcgttcacggtacgctcggcgaagacggcagcctgcagggtttgtta
cgtatggctaacttgccgttcgtgggttccggcgtgttaggctccgcggtgagtatggat
aaagacatcgctaaacgcctgctgcgtgacgcaggcctggccgtcgcgccctttatcacc
cttacccgcgtcaaccgctcgcaatatagcttcgaggatgttgtaacgaaacttggcgta
ccgatgttcatcaaacccgctaaccagggttcttcagtcggcgtaagtaaagtgacgacc
gccggggaataccagacggcggtggaactggcctttgaattcgatcataaagtggtggtg
gaaaccgggatcgtgggacgggaaatcgaatgcgccgtgctgggcaacgatcgcccggag
gccagtacctgcggcgaaatcgtggttaatagcgccttctattcctatgacaccaaatac
atcgatggtgatgccgcccgcgttgacgtgccggccaacattgcgccagaaataaacgat
aaaattcgtgcaattgcgatccgcgcctatcaggcgcttgaatgcagcggcatggcgcgt
gttgatgtgttcctgacgccagagaatgaggtcattattaatgaaatcaacacgctgcca
gggtttactaatatcagcatgtaccccaaattatggcaggccagtgggatgagctatcag
caactgattacgcgtttaattgagctggcgctggagcgccatgcccaggacagcgcgtta
aaaagcactatcacgccctaa

DBGET integrated database retrieval system