KEGG   Atlantibacter hermannii: NCTC12129_03592Help
Entry
NCTC12129_03592   CDS       T05790                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ahn  Atlantibacter hermannii
Brite
KEGG Orthology (KO) [BR:ahn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NCTC12129_03592 (ahpF)
Enzymes [BR:ahn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NCTC12129_03592 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 NAD_binding_8 Glutaredoxin K_oxygenase DAO AlaDh_PNT_C FMO-like DSBA
Motif
Other DBs
NCBI-ProteinID: VDZ74437
UniProt: A0A447LRT4
LinkDB All DBs
Position
1:complement(3238147..3239712)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLERLTKPVELVATLDDSAKSVEIKALLTEIAELSDKVSFREDNSLAA
RKPSFLITNPGSTQGPRFAGSPLGHEFTSLVLALLWTGGHPAKEAQELLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGAFQNEITDRGVMGVPAVFVNGKE
FGQGRMTLAEIVAKVDSGAEKRAADALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDTQSATKLIPAANEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILSAMTTEVKGD
GTKLTGLDYQDRETGSVKHLEVAGIFVQIGLLPNTTWLDGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaacccagctcaaggcttatcttgagcgtctgacaaagcct
gttgagttagtagccacgctggatgacagcgcgaaatcagtagaaatcaaagcgctgctg
accgaaatcgctgagctgtctgataaagtttctttcagagaagacaacagcctggcggca
cgtaaaccttcatttttgattacgaacccgggttccacccaggggccacgctttgctggc
tccccgctgggccacgaatttacctcgctggtgctggcgctgctgtggaccggtggtcat
ccggcaaaagaagcgcaggaactgctggagcagatccgcgatctggatggcgattttgag
tttgaaacttactattcactgtcctgccataactgcccggacgtggtgcaggcgctgaac
ctgatggccgtgctcaatccgcgtattaagcatactgcgattgacggcggcgcattccag
aacgaaatcaccgatcgcggcgtcatgggcgttccggcggtattcgttaacggtaaagag
ttcggccagggccgtatgacgctggcggaaatcgttgctaaagttgacagcggcgccgaa
aaacgcgcggctgatgcgctcaataagcgtgacgcttacgacgtactgatcgtgggttcc
ggccctgcgggcgcggcggcagcggtttattccgcccgtaaaggcatccgtaccggttta
atgggtgaacgtttcggcggccaggtgctggatactgtcgatatcgaaaactacatctcg
gtgccgaaaaccgaaggtcagaaactggcaggcgccctgaaagcgcacgttgatgattac
gatgtggatgtaattgacacccagagcgcgacgaagctgattccggcggcgaacgaaggc
ggcctgcatcagattgaaaccgcctccggcgcggtgctgaaagcacgcagcattatcatt
gcgaccggcgcgaaatggcgcaatatgaacgtccctggcgaagatcagtatcgcaccaaa
ggcgtaacctattgcccgcactgcgacggcccgctgtttaaaggtaagcgtgtggcagtc
atcggcggcggtaactccggcgttgaagcggctatcgacctggcgggtattgttgagcac
gtcaccctgctggaattcgcgccggaaatgaaagccgaccaggttctgcaggacaaactg
cgcagcctgaaaaacgtcgatatcatcctgagcgcgatgaccaccgaagtgaaaggcgac
ggcaccaaactgaccgggctggactatcaggaccgtgagaccggttccgtgaagcatctg
gaagtggcggggatcttcgtacaaattggtctgctgccgaacaccacctggctggatggc
gctatcgagcgtaaccgcatgggcgagatcatcatcgacgccaaatgcgaaaccagcgtg
aaaggcgtgtttgcggcgggcgactgcaccaccgtaccgtacaaacagatcatcatcgcc
accggcgaaggcgcgaaagcgtcgctgagcgcctttgattatctgattcgcaccaaaact
gcataa

DBGET integrated database retrieval system