KEGG   Atlantibacter hermannii: NCTC12129_03669
Entry
NCTC12129_03669   CDS       T05790                                 

Gene name
gatD_2
Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
ahn  Atlantibacter hermannii
Pathway
ahn00052  Galactose metabolism
ahn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NCTC12129_03669 (gatD_2)
Enzymes [BR:ahn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     NCTC12129_03669 (gatD_2)
SSDB
Motif
Pfam: ADH_N ADH_N_2
Other DBs
NCBI-ProteinID: VDZ74513
UniProt: A0A447LS04
LinkDB
Position
1:complement(3307131..3307718)
AA seq 195 aa
MTTMKEIVIPQNNQLEIRETDIPEYGDYDVLVKVIYSGLCGSDIPRIFHHGAHFYPVRLG
HEFSARVVATGSKVMSVKAGDHICCVPLIPNFAAPECQRGFYSLGKGYSFVGSRLPGGNA
QYVTMPESSCFLLPEGVTPLQGAFFEPVTVGVHPILMAGGCQDKNVIVLGGRHHRFTGHA
ERESAWREIGDGGGH
NT seq 588 nt   +upstreamnt  +downstreamnt
atgacgaccatgaaagagattgttattccgcaaaacaaccagctggaaatccgtgagact
gacatcccggaatacggtgattacgatgtgctggttaaagtgatttattccgggctgtgc
ggttccgatattccgcgtattttccatcacggcgcgcatttttacccggttcgtttgggg
catgagttttctgcgcgggtggtggccaccggcagtaaagtgatgtcggtaaaggcaggc
gatcacatctgctgtgtgccgctgatccccaattttgcagcgccggaatgccagcgcggc
ttctattcgttgggtaaagggtattcgtttgtcggctcccgtttaccgggcggcaatgcc
cagtacgtcaccatgccggagagcagctgttttttactgccggaaggcgtgacgccgttg
cagggcgcgttctttgaacccgtcaccgtgggcgtgcatcccatcctgatggcggggggc
tgccaggacaaaaacgttattgtgctggggggtcggcaccatcggtttactggccatgca
gagcgcgaaagcgcttggcgcgaaatcggtgacggcggtggacattaa

DBGET integrated database retrieval system