KEGG   Atlantibacter hermannii: NCTC12129_04535
Entry
NCTC12129_04535   CDS       T05790                                 

Definition
(GenBank) DotU family type IV/VI secretion system protein
  KO
K11892  type VI secretion system protein ImpK
Organism
ahn  Atlantibacter hermannii
Pathway
ahn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ahn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NCTC12129_04535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ahn02044]
    NCTC12129_04535
Secretion system [BR:ahn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NCTC12129_04535
SSDB
Motif
Pfam: DotU MICSWaP
Other DBs
NCBI-ProteinID: VDZ75332
UniProt: A0A447LUF8
LinkDB
Position
1:complement(4097759..4098448)
AA seq 229 aa
MNARKYGTAASIDIDALLQNSWLQVISLRHGPRFQEGEGRILWERCVTDIERVQHALKEA
ELDDASCEHILTALCALLDEAVKGRGVEDDACVQWYDIPLQGYFFGTMDAGDTLCNRMRD
VLREPAPDNAVLTCFQRVMMLGFLGEFRSLNDPERQKLVKALNDQVSPFSYPQTHPVLAE
SRAGRGMWDWLSPLPVRIGLSVLVIVGLWWGLSHWLDQMLVTLLPGTVR
NT seq 690 nt   +upstreamnt  +downstreamnt
atgaacgcgcgtaaatacggcaccgccgcatccattgatattgacgcgctgctgcagaac
agctggctacaggtaatcagcctgcgtcatggcccccggtttcaggagggcgaaggacgg
atcctgtgggaacgctgtgttactgatatagagcgggtacaacacgcactgaaggaggcc
gagctggatgacgccagctgtgagcatattcttacagcactttgcgcattacttgatgag
gcggtcaaagggcgtggcgtagaggacgacgcttgcgtgcaatggtatgacattccgctc
cagggctatttcttcggcacgatggatgccggtgacaccctgtgtaaccgtatgcgggat
gtactgcgtgagcctgcgcctgataacgcggtcctcacctgttttcaacgcgtcatgatg
ctgggcttcctcggtgaattccgatcgttgaatgaccctgagcgtcagaagctggttaaa
gcgctcaacgaccaggtttctcccttcagctatccgcaaacccatccggtactggcagaa
agtcgtgcgggacgggggatgtgggactggttgtctcccttgcctgtgcgcattggcctg
agcgttctggtgatcgtcgggctgtggtgggggttgagccactggctcgatcagatgttg
gtgacgttgttacccgggacggtgagatga

DBGET integrated database retrieval system