KEGG   Acidianus hospitalis: Ahos_2277Help
Entry
Ahos_2277         CDS       T01493                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K14465  succinate semialdehyde reductase (NADPH) [EC:1.1.1.-]
Organism
aho  Acidianus hospitalis
Pathway
aho00720  Carbon fixation pathways in prokaryotes
aho01100  Metabolic pathways
aho01120  Microbial metabolism in diverse environments
aho01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aho00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ahos_2277
Enzymes [BR:aho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Ahos_2277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_3 Sacchrp_dh_NADP TrkA_N 2-Hacid_dh_C KR
Motif
Other DBs
NCBI-ProteinID: AEE95148
UniProt: F4B9K2
LinkDB All DBs
Position
2068727..2069815
Genome map
AA seq 362 aa AA seqDB search
MKGAVLYKYNEPLKIEDNLQIQSPKEGEVKVKIVATGMCHSDINVFEGKTPVPPPVIAGH
EIAGIVEEVGPGVTRVKPGDRVVSAFIHPCGKCRNCISGHENLCETFSAVRLKGTMMDGT
TRVRLDGKEVRTFLGGGFAEYAVVGENALTVVPPEVDLEKIAVLGCAGLTGYGAVNSAKI
EPGESVAVIGVGGVGLSVIQLLKASGAGRIIAVGTKKWKLDRAIELGATDVVNSKETDPI
KAIKELTNGGADVVIEAGGNEETIKMAMDSVRIGGRVVLVGLPPVNAMIPFRVASIVRNG
ITIIGNYGGRPRIDMPRLLDLVRLGKYDPSKLITGRFKLEEINEAVKLLNQGEAIRSLII
PD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggagctgttctgtataaatataatgaacctttaaaaattgaagataatctacaa
attcaatctcccaaagaaggagaagtcaaagtcaaaattgtagctacaggaatgtgccat
tcagatattaacgtatttgaaggaaaaactccagtacctcctccggtaattgccggccac
gagattgcgggaatagttgaagaagtaggtccaggtgttactagagttaaacctggagat
agagtagtctcagcatttatacacccatgcgggaaatgtagaaattgcatttctggccat
gaaaacttatgcgaaacgttctccgcagtaaggttaaagggcacaatgatggacggcact
actagggtaaggcttgacggaaaggaagttaggactttcttaggtggaggatttgccgaa
tatgctgttgtaggagaaaacgcattaactgtagttccaccagaagtcgatttagagaaa
attgcagtactaggttgtgcgggtcttactggttatggagcagtaaactcagcaaaaata
gagccaggagagtcagttgcagtaataggagttggaggagtaggattatcagtaattcaa
ttgcttaaggcaagcggagcaggaagaataatagcagtaggtactaaaaaatggaaatta
gatagagcaatagaattaggagcaacagacgtagttaactcaaaggagactgacccaata
aaagcaataaaagaattaactaacggaggagcagatgtagtaatagaggcaggcggaaat
gaagaaaccataaaaatggcaatggattctgtaagaataggaggtagagtagtattagtt
ggtttgcctccagtgaatgcaatgatacctttcagagtcgcgtcaattgttagaaacgga
ataacaataataggaaactacggaggaagaccaagaatagacatgcccagactcctggat
ctagtgagacttggtaaatatgacccatctaaactaataacaggaaggtttaaattagaa
gaaataaacgaagcggtaaaattacttaaccaaggagaggcaattagaagtttaataatt
ccagattag

DBGET integrated database retrieval system