KEGG   Aeromonas hydrophila pc104A: V429_00010
Entry
V429_00010        CDS       T03193                                 

Definition
(GenBank) DNA polymerase III subunit beta
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03030  DNA replication
ahp03430  Mismatch repair
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    V429_00010
   03430 Mismatch repair
    V429_00010
   03440 Homologous recombination
    V429_00010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ahp03032]
    V429_00010
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_00010
Enzymes [BR:ahp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     V429_00010
DNA replication proteins [BR:ahp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     V429_00010
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     V429_00010
SSDB
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_3 DNA_pol3_beta_2
Other DBs
NCBI-ProteinID: AHX67329
LinkDB
Position
1612..2715
AA seq 367 aa
MQLEISREALLRPLQLVSGALGGRPTLPILGNVLLDVSNGLLSLTGTDLEVEMIGQVYLN
SDSQDGRTTVPARKLLDICRGLPEGADIRLNTEGERLIIRSGRSRFNLSTLPATEYPNIE
DWESVLEFDIGQLELKKLIDATQFSMASQDVRYYLNGMLFESEGHGLRTVATDGHRLATC
RREVVTESLPDHQVILPRKGVLELVRLLEAEDKPVRLQIGRSNLRAALDGFIFTSKLVDG
RFPDWRRVIPRNSDKALIAGREDLRQAFARAAILSNEKFRGVRLNLQENLLRITANNPEQ
EEAEELLDVQYEAGEMEIGFNVSYVLDVLNTLKCDQIRISLSDSISSAIIEDFDSQDAQY
VVMPMRI
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgcagctcgaaattagccgtgaggccctgttacgtcctctgcaactggtgtccggtgcc
ctcggtggccggccgaccctgccaatcctcggcaacgtgctgctggatgtgagcaacggt
ctgctgtcactgaccgggaccgacctcgaagtggagatgatcggtcaggtctatctcaac
agcgacagtcaggatggccgcaccacagtgccggcgcgcaagctgctggacatctgccgc
ggtctgccggagggggcggacattcgcctcaataccgaaggcgagcgcctgatcatccgt
tctggtcgctcccgcttcaacctgtcgaccctgccggccaccgaatacccgaacatcgag
gattgggaatccgtactcgagttcgacatcggccagctggagcttaaaaagctcatcgat
gccacccagttctccatggccagccaggacgtgcgttactacctgaacggcatgctgttc
gagagcgagggccacggactgcgtaccgtggcgaccgacggccaccggctggcgacctgc
cgccgcgaggtggtaacggaatcgctgcccgatcatcaggtcatcctgccgcgcaagggc
gtgctggaactggtgcgcctgctggaagcggaagacaagccggtgcggctgcagatcggt
cgcagcaacctgcgtgccgcgctggatggcttcatcttcacctccaagctggtagatggc
cgcttcccggactggcgccgcgtcattccgcgcaacagcgacaaggccctgatcgccggt
cgtgaggatctgcgccaggcctttgcccgtgccgccatcctctccaacgagaaattccgt
ggggtgcgtctcaatctgcaggaaaacctgctgcgcatcaccgccaacaacccggaacag
gaagaagccgaagagctgcttgacgtacaatacgaagccggcgagatggagattggtttc
aacgtgtcttatgtgctggacgtgctgaatacgttaaaatgtgaccaaatccggatcagc
ctgagtgattccatcagcagcgccattattgaggattttgacagtcaggatgctcagtac
gtggtaatgccgatgcggatctag

KEGG   Aeromonas hydrophila pc104A: V429_03870
Entry
V429_03870        CDS       T03193                                 

Definition
(GenBank) hypothetical protein
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03030  DNA replication
ahp03430  Mismatch repair
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    V429_03870
   03430 Mismatch repair
    V429_03870
   03440 Homologous recombination
    V429_03870
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ahp03032]
    V429_03870
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_03870
Enzymes [BR:ahp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     V429_03870
DNA replication proteins [BR:ahp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     V429_03870
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     V429_03870
SSDB
Motif
Pfam: DNA_III_psi
Other DBs
NCBI-ProteinID: AHX68046
LinkDB
Position
complement(808582..809061)
AA seq 159 aa
MQDPVQLTTAREPAPAQPDQASGRLRQHLLARMGIPSWQLRRPALLAGHQVAPAPANEIP
ASEQAAAPASAVPSEPPSGKLWILASRLPAPGLLADLCQLLGIGSDEVSLLSSLPVGHTP
PLLWLEAADPAWPEALICPLAPSPAQKRALWQQLKGRLG
NT seq 480 nt   +upstreamnt  +downstreamnt
atgcaagatccagtgcagctgaccacggcgcgggagcccgcccccgcgcaacctgaccag
gcatccggtcgcctgcggcaacacctgctggcccggatgggcatcccgagctggcaactg
cgccggccagccctgctggcgggccatcaggttgcgcccgcgccggccaatgagatcccg
gcaagcgagcaggcggcggcccccgcctcggccgtgccgagcgagccgccaagcggcaag
ctctggatcctggcgagccggctgcccgcccccggcctgctggcggatctctgccagctg
ctcggcatcggcagcgacgaggtcagcctgctgagcagcctgcccgttggccacactccg
cccctgctctggctggaggcggccgatcccgcctggccagaggccctgatctgcccgctc
gcgcccagcccggcccaaaaacgggcgctgtggcagcagctcaaggggcgcctcggctga

KEGG   Aeromonas hydrophila pc104A: V429_06550
Entry
V429_06550        CDS       T03193                                 

Gene name
dnaE
Definition
(GenBank) DNA polymerase III subunit alpha
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03030  DNA replication
ahp03430  Mismatch repair
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    V429_06550 (dnaE)
   03430 Mismatch repair
    V429_06550 (dnaE)
   03440 Homologous recombination
    V429_06550 (dnaE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ahp03032]
    V429_06550 (dnaE)
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_06550 (dnaE)
Enzymes [BR:ahp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     V429_06550 (dnaE)
DNA replication proteins [BR:ahp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     V429_06550 (dnaE)
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     V429_06550 (dnaE)
SSDB
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP HHH_6 tRNA_anti-codon
Other DBs
NCBI-ProteinID: AHX68544
LinkDB
Position
1384768..1388247
AA seq 1159 aa
MAEPRFIHLRVHSDFSMVDGLQKINPIVGAAAANNMPALALTDQMNMCGLVRFYGAAHGK
GVKPIVGADFWVQSDELGDEQFRLTLLAMDNDGYQNITLLISRGYQRGHVQGRPVIDKAW
LAEHAKGVIVLSGGREGDVGKFLLKGNRQMTEQCLAFYQTHFPDAYYLELLRTGRPDEEV
YLHMAVAIATEFALPVVATNEVVFLTADDFDAHEIRVAIHDGYTLMDKRRPRRYSPQQYL
RSQEEMAELFADIPEALENTVEIAKRCNVTVRLGEYFLPNFPTGDMTTEDFLVMKSKEGL
EERLEFLFPDPAVRAERRPEYDERLDIELKVINQMGFPGYFLIVMEFIQWSKDNGIPVGP
GRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSMPDFDVDFCMDRRDEVIDHVSE
MYGREAVSQIITFGSMAAKAVVRDVGRVLGHAYGFVDRISKLIPPDPGMTLAKAFEAEPK
LPELYEQDEEVKDLIDMARRLEGVVRNAGKHAGGVVIAPTKITDFAPLYCDDEGHHPVTQ
FDKNDVEYAGLVKFDFLGLRTLTIIDWALGMINPRLAKEGKPPVDIAAIPIDDKRSFDLL
QRYETTAVFQLESRGMKDLIKRLQPDCFEDMIALVALFRPGPLQSGMVDNFIERKHGKEA
ISYPDEKWQHESLQPILEPTYGIILYQEQVMQIAQTLAGYTLGGADMLRRAMGKKKPEEM
AKQRAGFEEGAVKNGVDGELAMKIFDLVEKFAGYGFNKSHSAAYALVSYQTLWLKTHFPA
EFMAAVMTADMDNTDKIVTLVDECQRMGLTVIPPDVNTGRYRFSVNEDGHIVYGIGAVKG
VGEGPIDAILEARDRDGPFRDLFDFCNRVDIKKLNKRVMEKLILSGAMDRLGPHRAALMA
TLEEAMRAAEQHAKAQAVGQVDMFGVLTEEIDDVKKAFANVPHWPDKVWLEGERETLGLY
LTGHPINQYSGELRRYTSGRLCDLHPTSRDTVTTAAGLVIAARSMVTKRGNKMGIFTLDD
RSGRLDVTLFSEALEKYEELMQKDRILVVSGQVSFDDFSGGLKMSARELLDINDARERFA
RAIRISLDEQQIDDRFFPRLCEILEPARAGVCPVQVNYRRPGSRARLTLGTEWRVTPTDQ
LIDDLRVLLGRERVELVFD
NT seq 3480 nt   +upstreamnt  +downstreamnt
atggctgaaccccgttttatccacctgcgggtccactccgacttctccatggtcgacggc
ctgcagaagatcaaccccatcgtcggcgcggcggcggccaacaacatgccggcgctggcg
ctgaccgaccagatgaacatgtgcggcctggtgcgtttctacggcgccgcccacggcaag
ggcgtcaagcccatcgtcggggccgacttctgggtgcagagtgacgagctcggcgacgag
cagttccgcctcaccctgctcgccatggacaacgacggctaccagaacatcacattgctc
atctcccgcggctatcagcgcggtcacgtgcaggggcgcccggtcatcgacaaggcctgg
ctggccgaacatgccaagggggtgatcgtgctctccggcgggcgcgagggggacgtgggc
aagttcctgctcaagggcaaccgccagatgaccgagcagtgtctggccttctatcagacc
cacttccccgatgcctattatctggagctgctgcgtaccggccgccccgatgaagaggtc
tacctgcacatggcggtggccattgccaccgagttcgcactgccggtggtggccaccaac
gaggtggtgttcctcaccgccgatgacttcgatgcccacgagatccgggtcgccatccac
gatggctacaccctgatggacaagcgccggccgcgccgctacagcccgcagcagtatctg
cgcagccaggaggagatggcggagctgtttgccgacatccccgaggcactggagaacacg
gtggagatcgccaagcgctgcaacgtgacggtgcgcctcggcgaatacttcctgcccaac
ttcccgaccggtgacatgaccaccgaagacttcctggtcatgaagtcgaaagaggggttg
gaggagcgactcgaattcctgttcccggatccggcggtgcgggccgagcgccgtcccgag
tatgacgagcggctcgacatcgagctcaaagtgatcaaccagatgggcttcccgggttac
ttcctcatcgtgatggagtttatccagtggtccaaggacaacggcatccccgttggcccg
ggccggggctcgggggcgggttctctggtggcttatgccctcaagatcaccgatctggat
ccgctggaatttgacctgctgttcgaacgtttcctgaaccccgagcgggtatccatgccc
gacttcgacgtcgacttctgcatggacagacgggacgaggtgatcgaccacgtctccgag
atgtacggccgggaagcggtatcgcagatcatcaccttcggcagcatggcggccaaggcg
gtggtacgggacgtgggccgggtgctgggccacgcctatggcttcgtcgatcgcatctcc
aagctgatcccgccggatccgggcatgacgctcgccaaggcgttcgaggccgaacccaag
ctgcccgagctctacgagcaggacgaggaggtcaaggacctcatcgacatggcgcgccgg
ctggaaggggtggtgcgcaacgccggcaaacacgccggtggcgtggtgatcgcgcccacc
aagatcaccgacttcgcaccgctctactgcgatgacgaaggccatcacccggtcacccag
ttcgacaagaacgacgtggagtacgccgggctggtgaagttcgacttcctcggcctgcgc
acgctcaccatcatcgactgggcgctcggcatgattaacccgcgccttgccaaagagggc
aagccgccggtcgacatcgccgccatccccatcgacgacaagcgctcgttcgacctgctg
cagcgctacgagaccactgcggtattccagctggaatcccgcggcatgaaggatctcatc
aagcggctgcagcctgactgcttcgaagacatgatcgcactggtggcgttgttccgcccg
ggcccgctgcagtcgggcatggtggacaacttcatcgagcgcaagcacggcaaggaggcc
atctcctatccggacgagaagtggcagcacgaaagcctgcagccgatcctcgagcccacc
tacggcatcatcctctatcaggagcaggtgatgcagattgcccagaccctggcgggttat
acgctgggcggcgcggacatgctgcgtcgggcgatgggcaagaaaaaacccgaagagatg
gccaagcaacgggccggcttcgaggagggcgcggtcaagaacggtgtcgacggcgagctg
gcgatgaagatcttcgatctggtggagaagtttgcaggctacggcttcaacaaatcccac
tctgccgcctatgcgctggtctcctaccagaccctctggctcaagacccacttcccggcg
gagttcatggcggcggtcatgaccgccgacatggacaacaccgacaagatcgtgaccctg
gtggacgagtgccagcggatggggttgaccgtgatcccgccggatgtgaacaccggtcgc
tatcgcttcagcgtcaacgaagacggtcacatcgtctacggcatcggcgcggtgaagggg
gtgggggaaggccccatcgatgcgatcctggaagcgcgggatcgggacgggccgttccgc
gatctgttcgacttctgcaatcgggtcgacatcaagaagctcaacaagcgggtgatggag
aagctcattctctccggcgccatggatcggctcggcccccaccgcgccgccctgatggcg
accctggaggaggcgatgcgcgccgccgagcagcacgccaaggcgcaggcggtgggtcag
gtcgacatgttcggcgtgctcaccgaagagatagacgacgtcaagaaggcgttcgccaac
gtgccgcactggcctgacaaggtgtggctggaaggggagcgcgagaccctcgggctttac
ctcaccggtcaccccatcaaccagtacagcggcgagctgcgtcgttatacctcgggccgg
ctgtgcgatctgcaccccacctcccgcgataccgtcaccacggccgccggcttggtgatt
gcggcgcgcagcatggtgaccaagcgtggcaacaagatggggatcttcaccctggacgac
cgttccggtcgcctcgatgtgaccctgttcagtgaagcgctggaaaagtatgaagaattg
atgcaaaaagaccgtattttggtggtttctggacaggtcagctttgatgacttctccggt
ggccttaaaatgtcggcccgtgaattactggatatcaacgatgcgagagagcgttttgcc
agggcgatccgcatctctctcgatgaacagcagattgatgatcgttttttcccgcgtttg
tgcgagattttggaacccgcccgtgccggagtttgtccggttcaggtaaactatcgtcgc
cccggttcccgggcacgattgacgctcggtaccgagtggcgggtgacgcccaccgatcaa
ctgatagatgacttgcgcgtcctgcttggacgagagcgggttgaattggtttttgattag

KEGG   Aeromonas hydrophila pc104A: V429_08920
Entry
V429_08920        CDS       T03193                                 

Definition
(GenBank) DNA polymerase III subunit epsilon
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03030  DNA replication
ahp03430  Mismatch repair
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    V429_08920
   03430 Mismatch repair
    V429_08920
   03440 Homologous recombination
    V429_08920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ahp03032]
    V429_08920
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_08920
Enzymes [BR:ahp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     V429_08920
DNA replication proteins [BR:ahp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     V429_08920
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     V429_08920
SSDB
Motif
Pfam: RNase_T DNA_pol_A_exo1
Other DBs
NCBI-ProteinID: AHX69004
LinkDB
Position
1912934..1913668
AA seq 244 aa
MNTPQLNRQIILDTETTGMNTAGGPVYLGHRIIEIGCVEVINRKLTGNHFHVYIKPDRLV
DPEAIQVHGITDEFLRDKPSFSQIADEFIEFIRGAELIAHNAPFDVSFMDYEFGKLGLNF
KTADICGITDTLAMARDLFPGKRNNLDVLCDRYGIDNSHRTLHGALLDAEILADVYLLMT
GGQTKLNLATESSENESNQDTSIRRLESNRPPLKVIRASAEIEAVHEARLDLVQKKGGAC
LWRQ
NT seq 735 nt   +upstreamnt  +downstreamnt
atgaacacaccccaactgaatcgccagatcattctggatactgaaaccacaggtatgaac
accgccggtggccccgtctatctgggacaccgcatcatcgagatcggctgtgtggaggtg
atcaaccgcaagctgaccggtaaccacttccacgtctacatcaagccggatcggctggtg
gaccccgaggccatccaggtgcacggcatcaccgacgagttcctgcgtgacaagccatcg
ttcagccagatcgccgacgagttcatcgagttcatccgcggtgccgagctgattgcccac
aacgcgccgtttgacgtgagcttcatggactatgagttcggcaagctcggcctcaatttc
aagactgccgacatctgcggcatcacggataccctggcgatggcgcgggacctgttcccg
ggcaagcgcaacaacctcgacgtgctgtgcgatcgctacggcatcgacaactcgcaccgt
accctgcacggggctttgctcgatgcggagatcctggcagacgtctacctgctgatgacg
ggtggccagaccaagttgaatctggctaccgaaagcagtgagaatgagagcaaccaggac
accagcatccgccggctggagagcaatcgcccaccgctcaaggtgatccgtgccagcgcc
gagattgaggcggtgcacgaggcgcggctggatctggtgcagaaaaaaggaggagcctgc
ctgtggcggcaatga

KEGG   Aeromonas hydrophila pc104A: V429_12015
Entry
V429_12015        CDS       T03193                                 

Definition
(GenBank) ATPase AAA
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03030  DNA replication
ahp03430  Mismatch repair
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    V429_12015
   03430 Mismatch repair
    V429_12015
   03440 Homologous recombination
    V429_12015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ahp03032]
    V429_12015
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_12015
Enzymes [BR:ahp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     V429_12015
DNA replication proteins [BR:ahp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     V429_12015
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     V429_12015
SSDB
Motif
Pfam: DNA_pol3_delta2 DNApol3-delta_C AAA AAA_5 Mg_chelatase QueC
Other DBs
NCBI-ProteinID: AHX69584
LinkDB
Position
complement(2588467..2589414)
AA seq 315 aa
MYPWLIPDWHALSQTAAAGRLGHAWLLLGDPGLGKEQLAEQLARLHLCHRPDRGEPCGQC
HSCQLFEKGHHPDLGTLTTESKTIGVEAIREICSRLQNSAQLGRGKVVIIPDAERMTESA
ANALLKTLEEPAGDSLLLLIASQVSRLLPTILSRCHKHVCQLPAEGETVRWLAEQGHQAT
LAQVRICQGAPLRVLRYIEEQQDSARRDLLESFLALAQTPTRANHVCGLLASDTQVRLHW
LQLFLCDALKTQAGCGHHQLAMPDLTALSQQLAELHSSEKLLEAEQQLVELKMACQPGQL
SNPTIHLMNWLTRWL
NT seq 948 nt   +upstreamnt  +downstreamnt
atgtatccctggttgatcccggactggcatgccttgagccagaccgctgcggctggccga
ctcggtcacgcctggttgctgctcggtgatcccggccttggcaaggagcagcttgcggaa
caattggcgcgcttgcacctttgccatcggcccgatcggggtgagccctgcggtcaatgt
cactcctgccagctgtttgagaagggccatcatccggatctgggcaccctgacgacggag
agcaagaccatcggagtcgaggccatccgcgagatctgttcacggctgcagaattcggcc
cagcttggtcgcggcaaggtggtgatcatcccggatgcggagcgcatgacggagtcggcc
gccaacgccctgctcaaaaccctggaagagcctgccggcgacagcttgctgttgctgatc
gcctcccaggtttcccgcctgttgccgaccattctcagtcgctgtcacaaacatgtctgc
cagttgcctgccgaaggtgagacggtgcgctggctggccgagcagggtcatcaggccacg
ctggcccaggtacggatctgccagggggcgccgctgcgggtgctgcgctatattgaagag
cagcaagacagtgcccgccgggatctgctggagagtttcctcgcgctggcacagacgcca
acccgggccaaccacgtgtgcggtctgctggcgagcgatacccaggtcaggctgcactgg
ttgcagctgttcttgtgcgatgccctcaagacgcaggcaggttgcggccatcatcagctg
gcgatgccggatctgacggcgctgagtcagcaactggccgagcttcattccagcgagaag
ctgctggaggcggagcaacagctggtcgagctgaagatggcctgccagcccggacagctc
tccaatcccaccatccatctaatgaactggctgactcgctggttatag

KEGG   Aeromonas hydrophila pc104A: V429_12245
Entry
V429_12245        CDS       T03193                                 

Definition
(GenBank) DNA polymerase III subunit gamma/tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03030  DNA replication
ahp03430  Mismatch repair
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    V429_12245
   03430 Mismatch repair
    V429_12245
   03440 Homologous recombination
    V429_12245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ahp03032]
    V429_12245
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_12245
Enzymes [BR:ahp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     V429_12245
DNA replication proteins [BR:ahp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     V429_12245
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     V429_12245
SSDB
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_tau_5 DNA_pol3_gamma3 AAA RuvB_N AAA_5 AAA_16 AAA_22 AAA_18 ResIII AAA_14 Rad17 AAA_30 TsaE AAA_19 TniB VirE SKI Mg_chelatase ERAP1_C DUF815 AAA_24 PIF1 AAA_7 ABC_tran Herpes_Helicase
Other DBs
NCBI-ProteinID: AHX69625
LinkDB
Position
complement(2639142..2641694)
AA seq 850 aa
MSYQVLARKWRPHTFEQVVGQHHVLTALTNALDQGRLHHAYLLSGTRGVGKTTIARILAK
SLNCEQGISSHPCGVCDTCSEIDQGNFVDLLEIDAASRTKVEDTRELLDNVQYRPARGRF
KVYLIDEVHMLSRHSFNALLKTLEEPPPYVKFLLATTDPQKLPITILSRCLQFHLKSLDQ
TQIAKQLEWVLDQEVQPFEPRALLALAKAADGSMRDALSLTDQALAHGNGSVRLDSVLAM
LGTLDHRHLHQLLEAVLRQDAPATMAKITEIATLGPDFDQLHAELEGLLHRIAMAQLLPA
TVQEQGADADALLQLAQAMSPEEVQLCYQIVLGGRKDLPWAPDGRTALEMTCLRMLAFSP
RREVLHPASLTALPLAMGGLATEARSGAAAPGKPQGAEPAPAASAAPQASSALAAAAPAA
TMAPVVMAEPATVEPALERQDNGAELDPLFAEQDELLREAEQMGYEAATLPAASGEMPAE
PSVAPSSEPVMAEPEPESIPQAEVVADAEAVPSTVSSMQSLLGKRNLLRSRLRSEPSAAT
SAARTAPAKPVAAARPATVMQPAAATPPSTFEPQPARVDGQGQASARPAPQTGYDELPPL
DAYEESGSDYEEYLSQGFSDAFASAPLPERTAEALSPAPVPAAVARPRSDDLPPWDLDGS
APRQATAASVAAPVTAPREVVASEPAPAASVMETIDWDELEGDSQPQAGEVAARLIPSSL
LNSCGDPWAELIARTGVGGRLRQLAINSVMSQQGDKVLLTLKPEQRHLISDRARADLAEI
IGPELGQPVQVEVTLGSVPEQETPLEIEHRLYLGVREQVTRDLEQDPNVQFLQQRFGAVL
HHDSIEPLSR
NT seq 2553 nt   +upstreamnt  +downstreamnt
atgagctatcaggttctggcgcgtaaatggcgcccccatacgtttgaacaagtggtaggc
cagcatcatgtgctgaccgccttgaccaacgccctggatcagggacggctgcatcacgcc
tatctgctgagcggcacccgcggggtcggcaagaccaccatcgcccgcatcctggccaag
agcctcaactgcgagcaggggatcagcagccacccgtgcggggtgtgcgacacctgcagc
gagatcgatcagggcaacttcgtcgacctgctggagatcgatgcggcgtcgcgcaccaag
gtggaagacacccgcgaactgctcgacaacgtgcagtaccggccggcccgtggccgcttc
aaggtctatctcatcgatgaagtgcacatgttgtcgcgccacagcttcaacgccctgctg
aaaaccctggaagagccgcccccctatgtgaagttcctgctggccaccacggatccgcag
aagctgccgatcaccatcctctcgcgctgcctgcagtttcatctgaagagtctggatcag
acccagatcgccaagcagctcgaatgggtgctggatcaggaggtgcaaccctttgaaccg
cgcgccctgctggcgctggcgaaggcggctgacggcagcatgcgcgatgccctgagcctg
accgatcaggcgctggctcacggcaatggcagcgtgcgcctcgatagcgtgctggccatg
ctgggcacgctcgatcatcgccatctgcaccagctgctggaggcggtgctgcgccaggat
gcgccggccaccatggccaagatcaccgaaatcgccaccctgggccccgattttgatcag
ctgcacgccgagctggaaggcttgctccatcgcatcgccatggcgcagctgctgcccgcc
accgtgcaggagcagggggcggacgctgatgccctgctgcagctggcccaggccatgagc
ccggaagaggtacagctctgttatcaaatcgtgctgggcggccgtaaagacttgccctgg
gcccccgatggtcgcaccgcgctggagatgacctgcctgcggatgctggccttctcgccc
cggcgtgaagtactgcaccccgccagcctgacggcgctgcccctcgccatgggagggttg
gcgacagaggcgagaagtggcgcagcggcgccgggaaagccccagggggctgagccggcc
ccggctgccagtgcagcgccacaggcttcgtctgcgcttgccgccgccgcgcctgccgcg
acaatggcccctgtggtgatggctgagccagcaactgtcgagccagctttggagagacag
gataacggcgccgagctggatccgctgtttgccgagcaggatgagttgctgcgcgaggcc
gagcagatgggctacgaggcggcgacgttgccggccgcgtccggcgaaatgccggcagag
ccgtctgtggctccttcctcagagcctgtcatggccgagcccgagcccgaatcaatcccg
caggccgaggtggtggccgacgcagaggccgttccctcgacggtctccagcatgcaaagc
ctgcttggcaagcgcaatctgctgcgcagtcgcttgcgtagcgaaccgtcggcggcgacc
agcgctgcgcgcactgctcctgccaaaccggtggctgccgccagaccggcaacggtgatg
caaccagctgccgccacgcccccctcgacgttcgagccgcaaccggcacgagttgatggg
caagggcaggcgtctgcccggccagccccgcagacggggtatgacgagttgccgccgctt
gatgcctatgaagagagcggcagcgactacgaagagtatttgagccaaggtttcagcgat
gcgttcgccagcgcccctctgccggagcggactgccgaggctttgtcaccggcgcctgtc
cccgcggccgttgcacgtcctcggtcagacgatctgccaccttgggatctggacggtagt
gcgcctcggcaggctaccgcagcgtctgtcgcggctcccgtgacggcccctcgcgaggtc
gttgccagcgagccggcgcctgcggcctcggtgatggagaccattgactgggacgagctg
gagggtgacagccagccgcaagcgggagaagtggcggccagattgatcccgtcctccctg
ctgaacagctgtggcgatccctgggccgagctgattgcccgcaccggtgtcggtggtcga
ctgcgtcagctggccatcaactcggtcatgagccagcagggggacaaggttctgttgacc
ctcaaaccggagcagcgccatctgatcagcgacagggcgcgcgccgatctggccgagatc
atcggccccgagctggggcaaccggtgcaggtggaggtcacgctgggcagtgtgcccgag
caggagacgccgctggagatagaacatcgcctctatctcggggtgcgtgagcaggtcacc
cgggatctggagcaggatcccaacgtgcaatttttgcagcagcgatttggcgccgtgctt
caccacgacagcatagagccgctgagtcgctga

KEGG   Aeromonas hydrophila pc104A: V429_13260
Entry
V429_13260        CDS       T03193                                 

Definition
(GenBank) DNA polymerase III subunit epsilon
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03030  DNA replication
ahp03430  Mismatch repair
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    V429_13260
   03430 Mismatch repair
    V429_13260
   03440 Homologous recombination
    V429_13260
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ahp03032]
    V429_13260
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_13260
Enzymes [BR:ahp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     V429_13260
DNA replication proteins [BR:ahp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     V429_13260
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     V429_13260
SSDB
Motif
Pfam: RNase_T DUF5051
Other DBs
NCBI-ProteinID: AHX69801
LinkDB
Position
2854176..2854802
AA seq 208 aa
MLSRLRRHWHGRRVQDPAFAPLYADPPADEWVALDFETTSLDPAQAEIVAIGAVRIQGNR
VLTGEALSIRVQAPASLSEHSVVIHGLRHQDLQQGMTLEAALRLLLAFIGPRELVGYHIA
YDLRILNLACQRCWGLTLAQRGIEVSRLYHDHLYRRYPDAAIDLHLAAISSHLGLPALPA
HDALSDAITAALIFLRLTRGGPLAYPKV
NT seq 627 nt   +upstreamnt  +downstreamnt
atgttgagccgtctgcgccgtcattggcatggccgccgcgttcaagatccggcgtttgcc
ccgctctatgccgacccgcccgctgacgagtgggtggccctcgacttcgagaccaccagc
ctggatcccgcccaggccgagatcgtcgccatcggcgcggtgcgcatccagggcaaccgg
gtgctgaccggcgaggcgctgtccatccgggtacaagcgccagccagcctgagcgaacat
tcggtggtgatccacggtctgcgccatcaggatctgcaacaaggcatgacgctggaagcc
gcactgcgcctgctgctcgcctttatcggcccgcgcgaactggtggggtatcacatcgcc
tacgacctgcgcatcctcaacctcgcctgtcagcgatgttgggggctgaccctggcgcag
cgcgggatagaggtgagccggctctaccacgatcacctctatcgccgctatcccgatgcc
gccatcgacctgcatctggccgccatcagcagccatctgggcctgccggccctgcccgcc
cacgacgccctgagcgatgccatcaccgccgccctcatcttcttgcgcctcacccggggc
gggccactggcttatcccaaagtctaa

KEGG   Aeromonas hydrophila pc104A: V429_18085
Entry
V429_18085        CDS       T03193                                 

Definition
(GenBank) DNA polymerase III subunit delta
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03030  DNA replication
ahp03430  Mismatch repair
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    V429_18085
   03430 Mismatch repair
    V429_18085
   03440 Homologous recombination
    V429_18085
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ahp03032]
    V429_18085
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_18085
Enzymes [BR:ahp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     V429_18085
DNA replication proteins [BR:ahp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     V429_18085
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     V429_18085
SSDB
Motif
Pfam: DNA_pol3_delta DNA_pol3_delt_C DNA_pol3_gamma3
Other DBs
NCBI-ProteinID: AHX70679
LinkDB
Position
3956110..3957141
AA seq 343 aa
MRVYPEQFADHLKAGLKPCYLIFGDEPLLKLEAIDAVRQVARKQGFDERHSFVVEQGLDW
NQVYDACQAMSLFSARQIIELELPAKVDKELAARISEIGKQLHPDLLLVLSGSRLNQTQM
KTAWFDKLSQSGTYVPVNHPEPRFFPRWMSARFQRFGLKALPDAVNFMCHSYEGNLLAAS
QEIEKLTLLSPPQPISVAYLQETIIRHAHFTPFQLIDTLLEGKVNRAQRILLALRAEGTE
PGMLAWALCRELEQLTELALAARAGQPLVEHFSRLRIWQSRQQLIQQALTRLPFAKLQQL
WQLMARLDDAQRRFDTEQAWLMLQTLALGFRDGTPLPLAGSDA
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgagagtctatcccgagcagtttgcggatcacctcaaagcagggctcaagccctgctat
ctcatttttggggacgagcccttgctcaagctggaagccatcgatgccgtgcgccaggtg
gcgcgcaaacagggcttcgatgagcgccacagcttcgtggtagaacagggactggactgg
aatcaggtctacgatgcctgccaggccatgagcctgttctcggcccgccagatcatcgag
ctggagctgccggccaaggtcgacaaggagttggccgcccgcatcagcgagatcggcaag
cagctgcaccccgacctgctgctggtcctgagcggtagtcgcctcaaccagacccagatg
aagacagcctggttcgacaagctgagccagagcggcacctatgtgccggtcaaccacccc
gagccccgcttctttccgcgctggatgagcgcccgcttccagcgcttcggcctcaaggcg
ctgccggatgcggtcaacttcatgtgccactcctacgagggcaacctgctggccgccagc
caggagatagagaagctgaccctgctctcgccgccccagcccatcagcgtcgcctatctg
caggagaccatcatccgccacgcccacttcaccccgttccagctcatcgacaccctgctg
gaagggaaggtgaatcgggcccagcgcatcctgctggccctgcgcgccgagggcaccgag
cccggcatgctagcctgggccctctgccgcgagctggagcagctcaccgagctggcactc
gcagccagggccggtcagccgctggtggagcacttctcccgcctgcgcatctggcagagc
cgccagcagctcattcaacaggcgctgacccggctgcccttcgccaagctgcagcagttg
tggcaactgatggcccggctcgacgacgcccagcgtcgcttcgataccgaacaggcctgg
ctgatgctgcagaccctcgccctcggttttcgcgatggcacccccttgccgctggcggga
tctgacgcatga

KEGG   Aeromonas hydrophila pc104A: V429_20550
Entry
V429_20550        CDS       T03193                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03030  DNA replication
ahp03430  Mismatch repair
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    V429_20550
   03430 Mismatch repair
    V429_20550
   03440 Homologous recombination
    V429_20550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ahp03032]
    V429_20550
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_20550
Enzymes [BR:ahp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     V429_20550
DNA replication proteins [BR:ahp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     V429_20550
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     V429_20550
SSDB
Motif
Pfam: DNA_pol3_chi PP28
Other DBs
NCBI-ProteinID: AHX71122
LinkDB
Position
4442311..4442766
AA seq 151 aa
MSQVTFYLMSEQDDAQASAVERLACQLVADSWGAGQLYLLCDDEAQALRLDELLWQLPPE
RFVPHQLQGESGQAPVEIGHQPPRRRYARLINLAKQTPLFAGHFAQVVDFVPTDETQKQQ
ARERYKHYRQAGHTLEMRDQPVLAAPDPAQP
NT seq 456 nt   +upstreamnt  +downstreamnt
atgagccaagtgaccttttacctgatgagcgagcaggatgacgcgcaggcttcggccgtc
gaacgcctcgcctgccagctcgtagccgatagctggggcgcgggccagctctacctgctg
tgcgacgacgaagcgcaggccctgcgcctcgacgagctgctgtggcagctgccgccggag
cgcttcgtgccgcaccagttgcagggcgagagcggtcaggcaccggtggagatcggtcat
caaccaccacggcggcgctatgcccgcctcatcaatctggccaaacagacacctttgttt
gcaggacacttcgctcaagtggtagattttgtccccactgacgaaacgcaaaagcagcaa
gcccgcgagcgctacaagcactatcgccaggcaggccacaccctcgagatgagggatcag
cccgtccttgccgcaccggatccggcgcagccctga

DBGET integrated database retrieval system