KEGG   Aeromonas hydrophila pc104A: V429_00015
Entry
V429_00015        CDS       T03193                                 

Gene name
recF
Definition
(GenBank) recombination protein F
  KO
K03629  DNA replication and repair protein RecF
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    V429_00015 (recF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_00015 (recF)
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     V429_00015 (recF)
SSDB
Motif
Pfam: SMC_N AAA_23 AAA_15 AAA_21 AAA_27 AAA_29 DUF2813 ABC_tran AAA_22
Other DBs
NCBI-ProteinID: AHX67330
LinkDB
Position
2718..3821
AA seq 367 aa
MSLVKLQLSDFRNIQQASLALSPGLNILVGCNGSGKTSVLEAIHYLGLGRSFRTHLTGRV
IRQGERAFTLFAQCELEGRQVPIGLAKDKSGETQLKIAGAQAQRLAELAELLPVQLIHPD
GFNLLTGGPQARRAWLDWGVFHQEPTFFSLWGRVRRLLKQRNALLRQSSQYRQLAYWDQE
LVRLGGELAEFRASYCQAITPLIKEMTADFLPEFDISLGFYRGWEKDTALNALLEAGFER
DRALGYTGVGPQKADVRLKANGVPAQDILSRGQLKLLVCAMRLAQGLYLNQHSSRGCIFL
IDDFASELDVDKRRLLAARLKQCASQVFITAIDTGQLADMMDANDCKLFHVEQGKISETL
EKAESKL
NT seq 1104 nt   +upstreamnt  +downstreamnt
gtgtccctggtcaaactccagctcagcgactttcgcaatatccagcaggccagtctcgcg
ctgtcgcccggcctcaatatcctggtcgggtgcaatggcagtggcaagaccagcgtgctg
gaagccattcactacctcggtctcggtcgctcctttcgtactcacctgaccgggcgggtc
atccgccagggggagagggcgtttaccctgtttgcccagtgtgaactggaagggcgccag
gtgcccatcggcctcgccaaggacaagagtggcgagacccagctcaagatcgccggtgcc
caggcccagcgtctggccgagctggccgaattgttgccggtgcagttgatccatccggat
ggcttcaatctgctgaccggtgggccgcaggctcgtcgggcctggctcgactggggtgtt
tttcatcaggagccgaccttcttctccctgtggggacgagtgcggcggctgctgaaacag
cgcaatgcgctgctgcgtcagagcagccagtatcgccagctggcgtactgggatcaggaa
ttggtacggttgggcggtgaattggccgagtttcgcgccagttattgtcaggccattacg
cctctgatcaaggagatgacggcggattttttgccggaattcgatatcagccttggattc
tatcgaggctgggaaaaagataccgcgctcaatgcattgctggaggcggggtttgagcgg
gatcgggcgctgggttacacaggagtaggcccacagaaggccgatgtgcgactcaaggcg
aacggcgtccccgctcaggatattttgtccaggggtcagttgaagttgctggtctgtgcc
atgcgactggcccaagggctctatttgaatcaacatagcagccgtggctgtattttttta
attgatgattttgcctctgaactggatgtcgacaagcgccggttgctggccgcaaggctg
aagcagtgtgcgtcccaggtattcattaccgccatcgacaccggtcagctcgcagacatg
atggatgcgaatgactgcaagttgttccacgtggaacaaggcaagatctccgaaacgtta
gagaaggcagagagtaagctatga

DBGET integrated database retrieval system