KEGG   Aeromonas hydrophila pc104A: V429_00315
Entry
V429_00315        CDS       T03193                                 

Definition
(GenBank) ATP-dependent DNA helicase RecG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    V429_00315
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_00315
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     V429_00315
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     V429_00315
SSDB
Motif
Pfam: AlbA_2 HATPase_c_4
Other DBs
NCBI-ProteinID: AHX67383
LinkDB
Position
73438..74601
AA seq 387 aa
MEITELIEVLSRGEDSRHQFKENFTNADALAAEIVAFSNTAGGQIFIGVQNDGTVHGLSH
TDIDRLNQLISNSASQNVRPAVNPLTENVPHPNGTVMVVTVAEGVSKPYMDKNGAIWVKN
GSDKRRATSREEIQRLFQQAGLVHADETPVAGLGAGDVDQPYFETFFEQQFGEPLAQHKQ
PLPRLLSNMNLMNQGQLNVAGSLLFAKTPQYALPAFIVKAVAFVGIDIEEQRYIDSRDIS
GKLADVFQQTLGFVVANTRATQGEQGFNSQGQAEIPRIVWEELVANALIHRDYFISAPVR
VLVFADRVEIISPGHLPNNLTIENIKAGNSNMRNPILASFAAKLLPYRGLGSGLLRALRV
WPQIELIDDRAGNLFKASVARPQEKRA
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggaaatcacagagctgatcgaagttttaagccgtggcgaagacagccgccatcagttc
aaggagaacttcaccaatgccgacgcgctggcagcggagatcgtggctttcagcaacact
gctggcgggcagattttcattggcgtgcaaaacgacggcacagtgcatggcttgtctcac
acggacatcgaccgcctgaaccagctcatctcgaacagcgcctcacaaaatgtgcggcct
gcggtgaacccgctcactgaaaacgtgccgcatccaaacggcaccgtgatggtggtcacc
gttgctgaaggcgtcagcaaaccctacatggacaagaacggagctatctgggtaaagaat
ggttcggataagcgccgagccacctcgcgcgaagaaatccagcgtctgttccagcaggcg
ggtctggtgcatgcggatgagacgcccgtagcgggcttgggcgcgggtgatgtggaccag
ccctatttcgaaaccttcttcgaacagcaattcggcgagccgctcgcccagcataagcaa
ccgctgccgcggctcctgagtaacatgaacctcatgaaccaggggcagctcaatgtggct
ggtagcctcttgttcgccaaaacaccgcagtacgcactacccgccttcatcgtcaaggcg
gtggcctttgtcggcatcgatatcgaggagcagcgctatatcgacagtcgcgacatcagc
ggtaagctggccgatgtgttccagcagacgctgggctttgtcgttgccaacacccgtgct
actcagggtgagcagggctttaactcacaggggcaggccgagattccccgtattgtctgg
gaggagctggtcgccaacgcgctcatccaccgcgactacttcatcagcgcgccggtgcgc
gtgttggtgtttgccgatcgggtcgagatcatcagccccggtcatctgcccaacaacctg
accatcgaaaacatcaaggcgggcaactccaatatgcgcaacccgattctggcgtccttt
gccgccaagctgctgccttatcgcggactgggcagcggtctgctgcgcgcattgcgggtc
tggccgcagattgaactgatcgacgaccgggctgggaatctatttaaggccagcgttgcg
cggcctcaggagaaacgcgcatga

KEGG   Aeromonas hydrophila pc104A: V429_01510
Entry
V429_01510        CDS       T03193                                 

Definition
(GenBank) ATP-dependent DNA helicase RecG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    V429_01510
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_01510
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     V429_01510
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     V429_01510
SSDB
Motif
Pfam: Helicase_C RecG_wedge DEAD ResIII tRNA_anti-codon SecA_DEAD AAA_30 IMS_HHH SNF2_N
Other DBs
NCBI-ProteinID: AHX67595
LinkDB
Position
complement(327008..329077)
AA seq 689 aa
MKLDKISLDSLKGVGSKMQEKFERLGLATVQDLLFHLPLRYEDRTQVWPIGDLPPGLHGA
VEGEIQDTQLVMGRRRMLVCRISDGTGTLTLRFFNFTAAQKNSLSPGRLMRCFGEVRPGK
YGLEMAHPEYKLLGEEQAGQTEEALTPVYPTTEGLRQLTLRSLTDQALAQLDLYGVEELL
PAGLYPQQIDLAAALKLLHRPPPSVALALLESGQHPAQQRLVLEELLAHNLSVLKVRAQA
QTQLARALKPAPALVEQLLGALPFTPTGAQNRVVAEIGRDLQQSHPMMRLVQGDVGSGKT
LVAALAALQAIGNGCQVGLMAPTELLAEQHAINFAKWLEPLGIGVGWLAGKQKGKAREEA
LAAIADGSVKMVVGTHAIFQEQVVFQRLALVIIDEQHRFGVHQRLALREKGEREGVHPHQ
LIMTATPIPRTLAMTAYADLDTSIIDELPPGRTPITTVALPDSRRQDVIERVRLACEEGK
QAYWVCTLIEESEVLECQAAEDTAAELQNLLPGLHIGLVHGRMRPVEKQRVMEEFKAGIL
QLLVATTVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRGSVASHCVLLYHAPLSK
TAQSRLGVLRETNDGFLIAQRDLELRGPGELLGTRQTGLADLKIADLVRDQPLIPQVQKM
ARFLMDRHPSHVEPLIRRWLGLRDHYSNA
NT seq 2070 nt   +upstreamnt  +downstreamnt
atgaaattggataaaatctccctcgacagcctcaagggcgtcggcagcaagatgcaggaa
aagttcgagcggctggggctggccacggtgcaggatctgctgttccacctccccctgcgc
tacgaggaccgcacccaggtgtggcccatcggcgatctgccgcccggcctgcacggcgcc
gtcgagggggagatccaggacactcagctggtgatggggcgtcgccgcatgctggtctgc
cgcatcagcgacggcaccggcaccctcaccctgcgcttcttcaacttcaccgccgcccag
aagaacagcctgagccctggccggctgatgcgctgcttcggcgaggtgcgccccggcaag
tacgggctggagatggcccaccccgagtacaagctgctcggcgaggagcaggccggccag
accgaagaggcgctcacccccgtctacccgaccaccgaagggctgcgccagctcaccctg
cgcagcctcaccgatcaggcgctggcccagctcgacctctacggggtggaggagctgctg
cccgccggcctctatccccagcagatcgatctggccgcggccctgaagctgctgcaccgt
ccgcccccctcggtggcgctggccctgctcgagagcggccagcacccggcccagcagcgg
ctggtgctggaggagctgctggcccacaacctctcggtcttgaaggtgcgggcccaggca
caaacccagctggcccgcgccctcaagccggccccggcactggtcgaacagctgctcggt
gccctgccgttcacccccaccggcgcccagaaccgggtggtggcggagatcggccgggat
ctgcaacagagccaccccatgatgcggctggtgcagggggacgtgggctcaggcaagacg
ctggtcgcggcgctggccgccctgcaggccatcggcaacggctgccaggtggggctgatg
gcgccgaccgagctgctggccgaacagcacgccatcaacttcgccaagtggttggaaccg
ctcggcatcggagtcggctggctggcgggcaagcagaagggcaaggcacgagaagaagcg
ctggccgccatcgccgatggcagcgtcaagatggtggtgggcacccacgccatcttccag
gagcaggtggtgttccagcgcctcgccctggtcatcatcgatgaacaacacagattcggg
gtgcatcagcggctcgcactgcgggaaaaaggggagcgggaaggggtacatccccatcag
ctgatcatgaccgccacccccatcccccgtaccctggcgatgaccgcctatgccgacctc
gatacctccatcatcgacgagctgccaccgggccgcacccccatcaccacggtggcgctg
cccgacagccgccgccaggacgtgatcgaacgggtcagactggcctgcgaagagggcaag
caggcctactgggtctgcaccctgatcgaggagtcggaggtgctggagtgccaggccgcc
gaggacaccgccgccgagctgcagaacctgctgcccggcctgcacatcgggctggtgcac
ggccggatgcggccggtcgagaaacagcgggtgatggaggagttcaaggcgggcatactg
cagctgctggtcgccaccaccgtcatcgaggtgggggtggacgtgcccaacgccagcctg
atgatcatcgaaaacccggagcgactggggctggcgcagctgcaccagctgcgcggccgg
gtcgggcgcggctcggtggcctcccactgcgtgctgctctatcatgcccccttgtccaag
acggcccagagccggctcggggtgctgcgggagaccaacgacggctttctcatcgcccag
cgggatctggagctgcgcggcccgggcgagctgctcggcacccgccagaccggcctggcc
gatctcaagatcgccgatctggtacgcgaccagccgctcatcccgcaggtgcagaagatg
gcgcgcttcttgatggaccgccacccgagccatgtcgaacccttgatacgacgctggctc
ggtctacgggatcactattccaatgcttga

DBGET integrated database retrieval system