KEGG   Aeromonas hydrophila pc104A: V429_00920
Entry
V429_00920        CDS       T03193                                 

Definition
(GenBank) formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    V429_00920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_00920
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     V429_00920
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     V429_00920
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     V429_00920
SSDB
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS FbpA Ribosomal_S13 Zn_Tnp_IS1595
Other DBs
NCBI-ProteinID: AHX67491
LinkDB
Position
203940..204752
AA seq 270 aa
MPELPEVEVSRQGISPWLTGIKVTRVVVRDGRLRWPVPGEIQELVDLTIHRVSRRAKYLL
LETDFGTAILHLGMSGSLRVLDIGTPAEKHDHVDIELANGKLLRLNDPRRFGALLWTREP
AEAHALLAKLGPEPLTDAFNADYLRERAKGRSTAIKTFLMDNQVVVGVGNIYANEALYAA
GIHPKRAAGNISAERLGTLVAEIKRVLAEAIRQGGTTLKDFTSADGKPGYFVQQLQVYGR
GGQPCFHCHTLLSEIRLGQRTTVFCSHCQR
NT seq 813 nt   +upstreamnt  +downstreamnt
atgcctgaattaccggaagtcgaagtcagccgccagggtatctcgccctggcttaccggc
atcaaggtcacccgagtggtggtgcgggacggccgcctgcgctggccggtgccgggggaa
atccaggagctggtggatctcaccatccaccgggtcagccgccgcgccaagtacctgctg
ctggagaccgacttcggcaccgccatcctccatctgggcatgtcgggcagcctgcgggtg
ctggacatcggcaccccggccgagaagcacgatcacgtggatatcgagctggccaacggc
aagctgctgcggctcaacgatccgcgccgcttcggcgccctgctgtggacccgcgagccg
gccgaggcgcacgcgctgctcgccaagctggggccggagccgctcaccgatgcgttcaac
gccgattacctgcgtgagcgtgccaaggggcgcagcaccgccatcaagaccttcctgatg
gacaaccaggtggtggtcggggtgggcaatatatacgccaacgaggcactctacgccgcc
ggcattcaccccaagcgggcggcgggcaatatcagtgccgagcggctgggcaccttggtg
gccgagatcaagcgggtgctggccgaagccatccggcagggcggcaccaccctcaaggat
ttcaccagcgcagacggcaagccgggctatttcgtgcagcagctgcaggtgtacgggcgg
ggcggccagccctgttttcactgtcacaccctgctcagtgaaatccggctgggacagcgt
acgaccgtgttctgttcccactgccagcgctga

DBGET integrated database retrieval system