KEGG   Aeromonas hydrophila pc104A: V429_01075
Entry
V429_01075        CDS       T03193                                 

Definition
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03030  DNA replication
ahp03410  Base excision repair
ahp03420  Nucleotide excision repair
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    V429_01075
   03410 Base excision repair
    V429_01075
   03420 Nucleotide excision repair
    V429_01075
   03440 Homologous recombination
    V429_01075
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ahp03032]
    V429_01075
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_01075
Enzymes [BR:ahp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     V429_01075
DNA replication proteins [BR:ahp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     V429_01075
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     V429_01075
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     V429_01075
SSDB
Motif
Pfam: DNA_pol_A 5_3_exonuc_N DNA_pol_A_exo1 5_3_exonuc HHH_5
Other DBs
NCBI-ProteinID: AHX67520
LinkDB
Position
232058..234811
AA seq 917 aa
MAPSNPLILVDGSSYLYRAFFASQQADLRTSTGLPSGAVRVMANMMRSLRKQYPDCHVAV
VFDAKGKTFRDDIYPEYKANRASMPDDLRSQVAPIHQMIKAMGFPFLMVEGVEADDVIGT
LARQATEKQLPVLISTGDKDMAQLVSDHVTLIDTMKDVKTDREGVIEKFGVPPELIIDYL
ALMGDKVDNIPGMTGVGEKTALALLQGIGSIDEIAANLDKVAALGFRGSKAFADKFREQE
EQVRLSYVLATIKTDVALEQSLEELQLGPIDKEALLAVYREYELRNLIKELESGGAEENE
AEGDDEGAAPVAAIETDYRCILDEAEFDEWLARLQVAPLFAFDTETTSLDYMEARVVGVS
FAIEPGKAAYVPFGHDYLGAPVQLTEAVVLGKLKPLLEDPARLKVGQNLKYDRNVLLNHG
IELQGIAYDTMLESYVLNSTASRHDMDSLARRYLNAETISFEEIAGKGVKQLTFNQIELE
QAAPYAAEDADITLRLHQTLWGKLSAEPGLAKVFSEIELPLLPVLARMERLGTTIEPKLL
HQQSQEIEVRLAELEKQAHELAGQEFNLSSPKQLGEILFTKLGLPIIKKTPKGAPSTAEE
VLAELAETYELPQLLMEHRGLAKLKSTYTDKLPLMIKPQTGRVHTSYHQAVAATGRLSST
DPNLQNIPVRNEQGRRIRQAFIPCAGYKLVAADYSQIELRIMAHLSGDKGLLTAFAEGKD
IHKATAAEVFGVALEAVTSDMRRSAKAINFGLIYGMSAFGLAKQLGIGRAEAQKYMDLYF
ERYPGVLEYMERTRQQADAQGYVETLFGRRLYLPDIKSRNAGLRKAAERAAINAPMQGTA
ADIIKRAMINVDGWIRGIEDQSIRMLMQVHDELVFEIREEKLEEYIAIIKEKMSAAAELD
VPLVVEAGTGDNWDQAH
NT seq 2754 nt   +upstreamnt  +downstreamnt
atggcccctagcaatccccttattctggtcgacggctcttcatatctttaccgcgccttc
tttgcctcccagcaggccgatctgcgcacctcgaccggtttgccgagcggcgccgtccgt
gtcatggccaacatgatgcgcagcctgcgcaagcagtaccccgactgccacgtggccgtg
gtgttcgatgccaagggcaagacctttcgcgacgacatctaccccgaatacaaggccaac
cgggccagcatgccggacgatctgcgcagccaggtcgcgcctatccatcagatgatcaag
gcgatgggtttccccttcctgatggtggaaggagtggaggccgacgacgtgatcggtact
ctggcccgtcaggcgaccgagaagcagctgccggtgctgatcagcaccggcgacaaggac
atggcgcagctggtctccgaccatgtcaccctgattgacaccatgaaggacgtgaagacc
gatcgggaaggggtgatcgagaagttcggcgtaccgcccgagctcatcatcgactacctg
gccctgatgggggacaaggtggacaacattcccggcatgaccggcgtcggcgagaagacc
gcgctggccctgctgcaggggatcggcagcatcgacgagatcgccgccaacctcgacaag
gtggctgcgctcggtttccgtggctccaaggcgttcgccgacaagttccgcgagcaggaa
gagcaggtgcgcctctcctacgtgctggccaccatcaagaccgacgtggcgctggaacag
agtctggaagagctgcagctcggccccatcgacaaagaggctctgctggcggtctaccgt
gagtacgagctgcgcaacctgatcaaagagttggagtccggcggcgctgaggagaacgaa
gccgagggtgatgatgaaggtgccgcaccggtcgccgccatcgaaaccgactatcgctgc
atcctggacgaggccgaattcgatgagtggctggcccgtctgcaggtggcaccgctgttt
gccttcgataccgagaccaccagtctcgactatatggaagcgcgcgtcgtgggtgtctcc
tttgccatcgagccgggcaaggcggcctacgtgcccttcggccacgattatctgggggcg
ccggtgcagctgaccgaggccgtggtgctcggcaagctcaagccgctgctggaagatccg
gcccgtctcaaggtggggcagaacctcaagtacgatcgcaacgtgctgctcaatcacggc
attgagctgcagggcatcgcctacgacaccatgctcgagtcctatgtgctcaactctacc
gccagccgccacgacatggattcgctggcccgcaggtatctgaacgccgagaccatctcg
ttcgaagagatcgccggcaagggtgtcaagcagcttaccttcaaccagattgaactggag
caggcggctccttatgcggcggaagatgccgacatcaccctgcgtctgcatcagacgctg
tggggcaagctctctgccgagccgggtctcgccaaggtgttcagcgagatcgaactgccc
ttgctgccggtgctggcgcggatggagcggctcggtactaccatcgagcccaagctgctg
catcagcagagtcaggagatcgaagtgcgtctggcagagttggagaaacaggctcacgag
ctggccgggcaggagttcaacctctcctcgcccaagcagctgggggagatcctcttcacc
aagctggggctgccgatcatcaaaaagactcccaagggagcgccatccactgcggaagag
gtactggccgagctggcggagacctatgagctgccgcaactgctgatggagcaccgtggg
ctggccaagctcaagtccacctacaccgacaagctgccgctgatgatcaagccgcagacc
gggcgggtgcacacctcctatcatcaggcggtggcggcgaccggtcggctctcgtccacc
gatcccaacctgcagaacatcccggtacgcaacgaacaggggcgccgcatccggcaggcc
ttcatcccgtgcgccggttacaagctggtggcggcggactactcccagatcgagctgcgc
atcatggcgcacctctccggtgacaaggggttgctgaccgccttcgccgagggcaaggac
atccacaaggcgaccgccgccgaggtgttcggggtggcgctcgaggcggtgaccagcgac
atgcgccgcagtgccaaggcgatcaacttcggcctcatctatggcatgagtgccttcggt
ctggccaagcagctggggatcggccgcgccgaagcgcagaagtacatggatctctacttc
gaacgctacccgggcgtactggagtacatggagcgcacccgccagcaagcggatgcccag
ggttacgtcgaaaccctgtttggccgccgtctctatctgccggatatcaagtcacgcaac
gccggtctgcgcaaggcggccgaacgggccgccatcaacgcacccatgcagggtacggcc
gccgacatcatcaagcgcgccatgatcaacgtggatggttggatccgcgggattgaagac
cagtcgatccgcatgctgatgcaggtgcacgatgaactggtgttcgagatccgcgaagag
aagctggaggagtacatcgccatcatcaaggagaagatgtcagccgcagccgagctggat
gtgccgctggtggtggaagcgggtaccggtgacaactgggatcaggcccactga

DBGET integrated database retrieval system