KEGG   Aeromonas hydrophila pc104A: V429_01205
Entry
V429_01205        CDS       T03193                                 

Gene name
uvrD
Definition
(GenBank) DNA-dependent helicase II
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03420  Nucleotide excision repair
ahp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    V429_01205 (uvrD)
   03430 Mismatch repair
    V429_01205 (uvrD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_01205 (uvrD)
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     V429_01205 (uvrD)
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     V429_01205 (uvrD)
   MMR (mismatch excision repair)
    Other MMR factors
     V429_01205 (uvrD)
SSDB
Motif
Pfam: UvrD_C UvrD-helicase AAA_19 UvrD_C_2 AAA_30 Exonuc_V_gamma Viral_helicase1 AAA_12
Other DBs
NCBI-ProteinID: AHX67538
LinkDB
Position
262767..264938
AA seq 723 aa
MDVSTLLDGLNDKQRDAVAAPRCNLLVLAGAGSGKTRVLVHRIAWLMQVERCSPFSIIAV
TFTNKAAAEMRGRVEKVIGDGVRGMWIGTFHGIAHRLLRAHHLDAGLPQDFQILDSDDQY
RLIRRVLKALNLDEKHWVPRAVMGYINGKKDEGLRPGDIDLYGDPVTRTYQQIYKTYQET
CDRSGLVDFAELLLRAHELWLNKPHILEHYRDRFQNILVDEFQDTNGIQYAWLRMLAGDT
GKVMIVGDDDQSIYGWRGAKIENIQRFLTDYQGAETIRLEQNYRSTANILKAANCVIANN
AERLGKELWTEGAEGEPISLYAAFNEVDEARFVVGRLKDWKEKGGLLADCAILYRSNAQS
RVLEEALMQDAMPYRIYGGLRFFERQEIKDAMAYLRLINNRGDDASFERVVNTPTRGIGD
RTLEILRNNARDQGLNLWQSAKALLNDKVLTGRAGNAVRGFVELIDALESQVSRLPLHQQ
ADIAIQHSGLKAMYLAEKGEKSQARVENLDELVTACRQYQRPDELEDMSDLSAFLAHAAL
ESGENQADEYADAVQLMTLHSAKGLEFPLVLLVGVEEGMFPSQQSTEESGRLEEERRLCY
VGMTRAMEKLYICYAESRRIYGREMFHKPSRFIREMPAECLEEIRLRTQVSRPTQYGRFS
QNEVQQSFDASGIKLGQRVLHPKFGEGIVLNFEGVGQQSRVQIQFDDVGAKWLVTAYARL
EAL
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggacgtttcaaccctgctcgacgggctcaatgacaagcaaagagacgcggtggcggcc
ccccgttgcaacctgctggtgctggccggtgccggttcgggcaagacccgggtgctggtg
caccgtatcgcctggctgatgcaggtggaacgctgttcacccttctccatcatcgcggtg
acctttaccaacaaggcggcggccgagatgcgcggccgggtcgagaaggtgatcggcgac
ggcgtgcgtggcatgtggataggcaccttccacggcatcgcccaccgcctgctgcgggcc
caccatctggatgcagggctgccgcaggatttccagatcctcgattccgacgaccagtac
cgcctcattcgccgggtgctcaaagcgctcaacctcgacgagaagcactgggtcccgcgc
gccgtgatgggctacatcaacggcaagaaggacgaggggctgcgccccggcgacatcgac
ctctacggcgaccccgtcacccgcacctatcagcagatctacaagacctatcaggagacc
tgcgatcgctccgggctggtggattttgccgaactcttgctgcgcgcccacgagctgtgg
ctgaacaagccccacatcctcgagcactaccgcgatcgcttccagaacatcctggtggac
gagttccaggacaccaacggcatccagtacgcctggctgcggatgctggcgggcgacacc
ggcaaggtgatgatcgtcggcgacgatgaccagtccatctacggctggcgcggcgccaag
atagagaacatccagcgcttcctgaccgactatcagggcgccgagaccatccgcctcgag
cagaactaccgctccaccgccaatatcctcaaggccgccaactgcgtcatcgccaacaac
gccgagcgccttggcaaggagctgtggaccgagggggccgagggcgagccgatctcgctc
tatgccgccttcaacgaggtggacgaggcccgcttcgtggttggccgcctcaaggattgg
aaggaaaaaggtggcctcctggccgactgcgccatcctctatcgctccaacgcccagtca
cgggtgctggaagaggcgctgatgcaggatgccatgccttaccgcatttacggcggcctg
cgcttcttcgagcgccaggaaatcaaggacgccatggcctatttgcggcttatcaacaac
cgtggcgacgacgccagcttcgagcgggtggtcaacaccccgacccgcggcatcggcgat
cgcaccctggaaatcctgcgcaataacgcccgcgatcaggggctcaacctgtggcaatcg
gccaaggccctgctcaacgacaaggtgctgaccggtcgcgccggcaacgcggtgcgcggc
tttgtcgagctgatcgacgcattggagagccaagtctcccggctgcctctgcaccagcag
gcggatatcgccatccagcactccggcctcaaggcgatgtatctggcggaaaaaggcgag
aaatcccaggcgcgggtagagaacctggacgagctggtcactgcctgccgtcagtaccag
cgcccggacgagctggaggacatgagcgatctctccgccttcctcgcccacgcggcgctg
gaatccggcgagaatcaggcggacgaatatgccgatgcggtgcagctgatgaccctgcac
agcgccaaggggctggagttcccgctggtgctgctggtcggcgtcgaagaggggatgttc
cccagccagcaatccaccgaggagtcgggccggctggaagaggagcggcgcctctgttac
gttggcatgacccgcgccatggagaagctctacatctgttatgccgagagccgccgcatc
tacggccgcgagatgttccacaagccgagccgctttatccgcgagatgcccgccgagtgt
ctggaagagatccggctgcgcacccaggtcagccgccccacccaatatggccgcttcagc
cagaacgaggtgcagcagagcttcgacgccagcggcatcaagctcggccagcgggtgctc
catcctaaatttggggaaggaatcgtgctcaacttcgaaggggtcggccagcagagccgg
gtgcagatccagttcgacgacgtcggcgccaagtggctggtgacggcgtatgcccgcctt
gaggcgctgtaa

DBGET integrated database retrieval system