KEGG   Aeromonas hydrophila pc104A: V429_03595
Entry
V429_03595        CDS       T03193                                 

Definition
(GenBank) DNA mismatch repair protein MutH
  KO
K03573  DNA mismatch repair protein MutH
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    V429_03595
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_03595
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Strand discrimination factor
     V429_03595
SSDB
Motif
Pfam: MutH
Other DBs
NCBI-ProteinID: AHX67991
LinkDB
Position
complement(752670..753344)
AA seq 224 aa
MPTNPQSEQELLARAYAMAGFTLAQLAATAGIAVPADLRRDKGWVGQLIEWQLGASAGSK
PEQDFPDLGIELKTIPIDPQGKPLETTFVCVAPLIGVSGQQWEQSNVRNKLSRVLWIPVE
GSREIPIGERRIGMPLLWSPNEEEERLLRQDWEELMDMIVLGEVEQISARHGQVLQLRPK
AANNKALTRAIGRNGQPIMTLPRGFYLKIGFTHGLLQRHFALPA
NT seq 675 nt   +upstreamnt  +downstreamnt
atgcccactaacccccagtccgagcaggaattgctggcccgcgcctatgccatggcgggc
ttcacgctggcccagctggccgccacggccggtatcgccgtgccggcggatctgcgtcgt
gacaagggctgggttggccagctgatcgagtggcagctgggggccagcgccggcagcaag
cccgaacaggacttcccggatcttggcatcgaactcaagacgatccccatcgatcctcag
ggcaaaccgctggagacgaccttcgtctgcgtggcaccgctgatcggtgtcagcggccag
cagtgggaacaatccaatgtgcgcaacaagctctctcgcgtgctctggatcccggtggag
ggcagccgcgagatccccatcggtgagcgccggattggcatgccgctgttgtggagcccg
aatgaagaggaagagcggctgctgcgccaggactgggaagagctgatggacatgatagtg
ctgggagaagtggagcagatcagcgcccgccacggccaggtgctgcaactgcgtcccaag
gcggccaacaacaaggctctgacccgggccatcggccgcaacggccaaccgatcatgacc
ctgccgcgcggcttttacctcaagataggctttacccacgggctgctgcagcgccacttt
gccctgcccgcttga

DBGET integrated database retrieval system