KEGG   Aeromonas hydrophila pc104A: V429_04275
Entry
V429_04275        CDS       T03193                                 

Definition
(GenBank) DNA recombination protein RecO
  KO
K03584  DNA repair protein RecO (recombination protein O)
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    V429_04275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_04275
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     V429_04275
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      V429_04275
SSDB
Motif
Pfam: RecO_N RecO_C
Other DBs
NCBI-ProteinID: AHX68118
LinkDB
Position
899688..900395
AA seq 235 aa
MLTPAFVIHSRPYRETSQLVEVFTQDSGRFTLVARGSRGPRSPLKGLLQPFTLLTIAWRG
KGDLKNLTQVECPDHSLRLGGDRLFYGLYLNELVFYLLEAHTPFPEVFDAYARAIMALAD
GETPELPLRRFEFLLLQALGYAVDFEYAADDESPIQPELLYGFERELGFVACERAPDPRT
LFLGAHLLAFAEGRFDSPPLLQAAKRFSRLALQPYLGRRQLKSRELFLKRRNSQG
NT seq 708 nt   +upstreamnt  +downstreamnt
ttgctgaccccggctttcgtcatccacagtcggccctatcgggagaccagccagctggtc
gaggttttcacccaggatagtggccgttttactctggtggctcgcggttcccgcgggcca
cgctcgcctctgaaggggctgttgcaaccctttaccctgctcaccatcgcctggcgtggc
aagggcgatctcaagaatctcacccaggtcgagtgcccggatcactccctgcggctcggc
ggcgatcgcctcttctacggcctctatctcaacgagctggtcttctacctgctggaagcc
cacaccccgttcccggaagtgtttgacgcctatgcccgtgccatcatggcgctggccgac
ggcgagacgccggagctgcccctgcgccgcttcgaattcctgctgctgcaggcgctcggc
tacgcggtggacttcgaatatgccgccgacgacgagtcgccgatccagcccgagctgctg
tacggcttcgagcgtgaattgggctttgtcgcttgcgagcgggcgccggatccccgtacc
ctgtttctcggcgcgcacctgctggcctttgccgaggggcgcttcgacagtccgcccctg
ctgcaggcggccaagcgtttcagccggctggcactgcagccctatctggggcggcggcag
ttgaagagccgggagctgtttttaaaacgccgcaatagccagggttaa

DBGET integrated database retrieval system