KEGG   Aeromonas hydrophila pc104A: V429_04885
Entry
V429_04885        CDS       T03193                                 

Definition
(GenBank) DNA mismatch repair protein MutL
  KO
K03572  DNA mismatch repair protein MutL
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    V429_04885
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_04885
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Molecular matchmaker
     V429_04885
SSDB
Motif
Pfam: DNA_mis_repair MutL_C HATPase_c_3 HATPase_c DUF3851
Other DBs
NCBI-ProteinID: AHX68232
LinkDB
Position
1037761..1039629
AA seq 622 aa
MPIRILPPILANQIAAGEVVERPSSVVKELVENSLDAGADRVEIDIDKGGAKLIRIRDNG
GGVAKDELVLALSRHATSKVATLDDLEGINSLGFRGEALASISSVSRLTFTSRTAEQSEA
WQAQAEGREMSVTVKPAAHPVGTTVEVVDLFFNTPARRKFMRSEKTEFAHIDELVRRIAL
SRFDVTLILRHNGKVVRQYKAANTVAEQERRLAAVCGSPFMHHALAVESEHSDVRLWGWL
ATPEGARPQNDLQYTYVNGRMMRDKLINHAIRQAYDELLPADRFAAYVLYIELDPRQVDV
NVHPAKHEVRFHQARLIHDFIFQALFTALRQQGEASDEPLAETLVELPVSAPIEYPGQAP
RAEWYGAEHNYRAPAREVREGGSAGRASNYQPPEPPSRKAMRGMGSLLTTLPAVQGTPLA
EAETAPVAAAVPAKAGTWRALTLVEQAYLLLERDNRLALLSLVRAERLLLRHWLLETWGQ
GLAAQPLLLPVSFKLPKNLVALVEQQDRLLKRMGLELKSGGRDTMILTRVPALLRQTDLV
RLLPELLQLIESGSDSDAGQQAEVLCQWLVEQGISREKVYDFATANRLLTELVADFSDQL
ADVRMVRPLALASVLAEFADGH
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgccaatccgtatattgccgccgattctggccaaccagattgctgccggtgaggtggtg
gagcggccctcctccgtggtcaaggagctggtggaaaacagcctggatgcgggtgccgat
cgggtcgaaatcgacatcgacaagggcggagccaagctcattcgcattcgcgacaatggc
ggtggtgtggccaaagatgaactggtgctggcactgtcgcgccacgccacctccaaggtg
gcgaccctcgacgatctggaagggatcaacagcctgggctttcgcggtgaggcgctcgcc
tccatcagttcggtctcccgcctcaccttcacctcccgcacggcggagcagagcgaggct
tggcaggcgcaggccgaaggacgcgagatgagcgtcaccgtcaaaccggcggcccacccg
gtgggtaccacggtggaggtggtggatctcttcttcaacactccggcgcggcgcaagttc
atgcgcagcgaaaagaccgaattcgcccacatcgacgagctggtgcgccgcatcgcgctc
tcccgcttcgacgtcaccctgatcctgcgccacaacggcaaggtggtgcgtcagtacaag
gccgccaatacggtggcggagcaggagcgccggctcgccgcggtgtgcggctctcccttc
atgcaccacgcgctggcggtggagagcgagcacagcgacgtgcggctgtggggctggctg
gcgaccccggagggcgccaggccgcagaacgatctgcaatacacctatgtcaatggccgc
atgatgcgcgacaagctcatcaaccacgccatccgccaggcctatgacgagctgctgccg
gccgaccggttcgcggcttacgtgctctatatcgagctggatccccgtcaggtggacgtc
aacgtccatccggccaagcacgaggtgcgctttcatcaggcacgcctcattcacgacttc
atcttccaggcgctgtttactgccctgcgccagcaaggggaggcaagcgacgagcccctg
gccgagactctggtcgagctgccggtcagtgcccccatcgagtatccgggtcaggccccc
agagccgagtggtatggtgctgagcacaactaccgggcgccggcccgggaagtgcgggaa
gggggcagtgccgggcgagccagcaactaccagccacccgagccccccagccggaaggcg
atgcgcggcatgggatcgctgctcaccaccttaccggcggtgcagggcacgccgctggca
gaggctgaaaccgcgcctgttgccgctgccgtgcccgccaaagcggggacgtggcgggca
ttgaccctggtggaacaggcctatctgctgctggagcgagacaaccggctggccctgctg
tcgctggtgcgggctgagcgcctgctgctgcgccactggctgctggaaacctggggccag
gggctggcggcccagccactgctgctgccggtctccttcaagctgccgaaaaacctggtc
gcgctggtcgagcagcaggatcgtttgctcaaacggatggggctggagttgaaaagcggc
gggcgcgacaccatgatcctgactcgggtgccagcgttgctgcgccagaccgatctggtg
cgcttattacccgaattgctgcaactgatcgagagcggatctgacagtgatgccggccag
caggctgaagtactatgccaatggctggtggagcaggggataagtcgcgaaaaagtatac
gattttgccacggccaaccgcctgctgacggaacttgttgccgatttcagtgaccaactg
gcagacgttcgcatggtgcgcccgctggcgctggcgagcgtgctggccgagttcgccgat
ggccattga

DBGET integrated database retrieval system