KEGG   Aeromonas hydrophila pc104A: V429_06545
Entry
V429_06545        CDS       T03193                                 

Gene name
rnhB
Definition
(GenBank) ribonuclease HII
  KO
K03470  ribonuclease HII [EC:3.1.26.4]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03030  DNA replication
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    V429_06545 (rnhB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ahp03032]
    V429_06545 (rnhB)
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     V429_06545 (rnhB)
DNA replication proteins [BR:ahp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     V429_06545 (rnhB)
   Elongation factors (archaeal)
     V429_06545 (rnhB)
SSDB
Motif
Pfam: RNase_HII
Other DBs
NCBI-ProteinID: AHX68543
LinkDB
Position
1384139..1384729
AA seq 196 aa
MMIDIPEDRLVAGVDEVGRGPLVGDVVTAAVILDPANPIIGLNDSKKLSEKKRLALFDEI
KQKALAWSVGRASPAEIDELNILHATMLAMQRAVAGLSIAPELVFIDGNRCPALPMEARA
VVKGDSLVAAISAASILAKVTRDAEMTELDSRHPEYGFARHKGYPTAEHLAILAERGPLP
EYRKSFKPVRRALGIE
NT seq 591 nt   +upstreamnt  +downstreamnt
atgatgatcgatattcctgaggacaggctggttgccggtgtggacgaagtgggccgtggc
ccgctggtgggtgacgtggtcaccgccgcggtgattcttgacccggccaatcccatcatc
gggctgaacgactccaagaagctctccgagaagaagcgcctcgccctgtttgacgagatc
aaacagaaggcgctggcctggtccgtcggccgtgccagcccggcggagatcgacgagctc
aacatcctacacgccaccatgctggcgatgcagcgcgccgtggcggggctctccatcgcg
cccgagctggtcttcatcgatggcaatcgctgtccggcattgccgatggaggcccgcgcc
gtggtcaagggtgacagcctggtagccgccatcagcgccgcctccattctggccaaggtg
actcgcgatgcggagatgaccgagctggacagccgtcatcccgagtacggcttcgcccgc
cacaagggctatccgaccgcggagcacctcgccatcctggccgagcgcggcccgctgccc
gaatatcgcaaaagtttcaaaccggtgcgtcgcgcactggggatcgaatag

DBGET integrated database retrieval system