KEGG   Aeromonas hydrophila pc104A: V429_07065
Entry
V429_07065        CDS       T03193                                 

Definition
(GenBank) crossover junction endodeoxyribonuclease RuvC
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    V429_07065
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_07065
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     V429_07065
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     V429_07065
    RecFOR pathway proteins
     V429_07065
SSDB
Motif
Pfam: RuvC DUF3882
Other DBs
NCBI-ProteinID: AHX68644
LinkDB
Position
1506165..1506686
AA seq 173 aa
MSIILGIDPGSRITGYGVIRIVAGKAEYLGSGCIRTDLGELPSRLKQVYDGVSEIITQFK
PDEFAIERVFMARNADSALKLGQARGSAIVAAVNALLPVSEYSATQIKQAVVGTGGAAKE
QVQHMVTHLLKLSATPQADAADALGVALCHFHTRQILIKMAGRSTGSVRGRYR
NT seq 522 nt   +upstreamnt  +downstreamnt
atgagcatcattttggggatagacccgggttcgcgcatcacaggttacggggtcattcgc
atcgtggcaggcaaggcggagtacctgggctcgggctgcatccgcaccgacttgggcgag
ctgccgtcgcgcctcaagcaggtctatgacggggtgagcgagatcatcacccagttcaag
ccggacgagttcgccatcgagcgggtctttatggcgcgcaatgccgattctgctttgaag
ctgggtcaggctcgcggcagcgccatcgtggcggcggtcaatgccctgctgccggtgagc
gaatactcggccacccaaatcaagcaggcggtagtgggcaccggcggcgccgccaaggag
caggtgcagcatatggtgactcacctgctcaagctctcggccacgccccaggcggatgcg
gcggatgccctcggggtggcgctctgccacttccatacccgccagatcctgatcaagatg
gccgggcgtagcacgggatcggtgcgtggtcgttaccgctga

DBGET integrated database retrieval system