KEGG   Aeromonas hydrophila pc104A: V429_08755
Entry
V429_08755        CDS       T03193                                 

Definition
(GenBank) esterase
  KO
K01175  esterase [EC:3.1.-.-]
Organism
ahp  Aeromonas hydrophila pc104A
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    V429_08755
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     V429_08755
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 PGAP1 Hydrolase_4 Chlorophyllase2 DUF676 Thioesterase BAAT_C Esterase DUF915 Palm_thioest
Other DBs
NCBI-ProteinID: AHX68973
LinkDB
Position
complement(1877604..1878368)
AA seq 254 aa
MNFKEQGQGQPVVLIHGLFGSLDNLGLLARPLSEQYRVISVDLRNHGASFHSDEMSYPAQ
AADLLALLDRLGLEQVAIVGHSMGGKVGMQLAKLAPTRVAKLVVADIAPVAYPHARHQNV
FAGLNATLELAPQSRSEAEAILAQHIEIAGVRQFLLKSFAKTGHGWGWRFNVPALERNYA
NIMGWPDAQSRFEGPALFIKGGDSDYMQPEHTETVMAQFPAAKARVIAGTGHWLHAEKPV
LFNKLVVDFLSTGG
NT seq 765 nt   +upstreamnt  +downstreamnt
ttgaacttcaaggagcagggccagggccagcccgtcgtgctgatccacgggctgttcggc
agcctcgacaacctcggcctgctggcgcgcccgctgagcgaacaataccgggtcatcagc
gtcgatctgcgcaaccacggcgcctcctttcactccgacgagatgagctacccggcccag
gccgccgatctgctcgccctgctggatcggctcgggcttgagcaggtggccatcgtgggt
cactccatggggggcaaggtgggcatgcagctggcgaagctcgcgccaacgcgcgttgcc
aagctggtggtggccgatatcgcgccggtcgcctacccccacgcccgccaccagaatgtg
ttcgccggcctcaacgccaccctcgaactcgctccgcaaagccgcagcgaggcggaagcc
atcctggcgcagcacatcgagatcgccggcgtgcgccagttcctgctcaagtcgtttgcc
aaaaccgggcacggctggggttggcgtttcaacgtcccggcccttgagcgcaactacgcc
aacatcatgggctggcccgatgcacagagccgtttcgagggcccggcgctcttcatcaag
gggggggattccgactacatgcagcctgaacataccgagacggtgatggcgcaattcccc
gccgccaaggcccgggtcatcgctggtaccggtcactggctgcacgcagaaaagccggtt
ttgttcaacaaactggttgtggatttcctgtcgacaggcggttaa

DBGET integrated database retrieval system