KEGG   Aeromonas hydrophila pc104A: V429_10575
Entry
V429_10575        CDS       T03193                                 

Definition
(GenBank) exonuclease I
  KO
K01141  exodeoxyribonuclease I [EC:3.1.11.1]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    V429_10575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_10575
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.1  exodeoxyribonuclease I
     V429_10575
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     V429_10575
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     V429_10575
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      V429_10575
SSDB
Motif
Pfam: Exonuc_X-T_C RNase_T WSS_VP
Other DBs
NCBI-ProteinID: AHX69316
LinkDB
Position
complement(2254664..2256091)
AA seq 475 aa
MSKTAHAGSEPTFFFHDYETFGISPARDRPAQFAGIRTDADFNLIGEPLVIYCKPPADYL
PEPEACLITGITPQKAMKDGLCEADFIRQIHEQFATPGTCVLGYNSIRFDDEVTRYTLYR
NFYDPYAYAWQNGNSRWDILDMLRACYALRPEGIEWAFDEEGKPSFKLEKLTVANGVAHA
NAHDALSDVLATIEMAKLVKKAQPKLFGYLFDLRNKNKVKALIDVVTMKPLVHVSGMFSP
WQGCASWVSPLAWHPSNQNAVIMVDLTRDPTPLIELTSEEIRERLYTKKEELGDLAGIPV
KLVHINKCPVLAPAATLTAERADQLGIDREQCRKSLDLLRAHPEVREKLVEVFNQEFAGS
NDGDPDTQLYAGFFGHGDKSTMDLVRATPADLLGEREFAFTDSRLPEMLFRYRARNWPHT
LSETEQKRWRLHCSDYFSRRLPDYVPRLEALAEQNQGNERNFAILKSLYHYLENL
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgagcaaaacagcacacgccggcagcgagcccacttttttctttcatgattacgagacc
ttcggcatcagcccggccagggacagaccggcgcagtttgccggtattcgtacagatgcg
gatttcaacctcatcggtgagccgctggttatctattgcaagccgcccgcggactatctg
ccagagccggaagcctgcctcattaccggcatcacgccgcaaaaagcgatgaaggacggg
ctgtgcgaggcggatttcatccgccagatccacgagcagttcgccaccccgggcacctgc
gtgctgggctacaacagcatccgcttcgatgacgaggtgacccgctacaccctctatcgc
aacttctatgacccctatgcctacgcctggcagaacggcaactcccgctgggacattctc
gacatgctgcgggcctgctacgccctgcgcccggaggggatcgagtgggcgtttgacgaa
gagggcaagccaagcttcaagctggagaagctcaccgttgccaacggcgtggcccacgcc
aatgcccacgatgcgctctccgacgtgctggccaccatcgagatggccaagctggtgaaa
aaggcccagcccaagctgtttggctacctgtttgaccttcgcaacaagaacaaggtgaag
gccctcatcgacgtggtgaccatgaagccgctggtgcacgtctccggcatgttctccccc
tggcaggggtgcgcaagctgggtctcgccgctcgcctggcaccccagcaaccagaacgcg
gtgatcatggtggacctgacccgcgaccccaccccgctcatcgagctcaccagcgaggag
atccgcgagcgcctctacaccaagaaagaggagctgggggatctggcgggtattccggtg
aagctggtgcacatcaacaagtgcccggtgctggcgccggccgccaccctgacggcggag
cgcgccgaccagcttggcatcgaccgggagcagtgccgcaagagcctggatctgctgcgt
gcccaccccgaagtgcgggaaaaactggtggaagtgttcaatcaggagtttgccggcagc
aatgacggcgatccggatacccagctctacgccggcttcttcggtcacggcgacaagtcc
accatggatctggtgcgcgccaccccggcggatctgctgggtgagcgggagtttgccttc
accgactcacggctgccggagatgctgttccgctaccgcgcccgcaactggccgcacacc
ttgagcgaaacggagcaaaagcgctggcggctgcactgcagcgactacttcagccgccgt
ctgcccgactatgtaccgcgcctcgaggcgctggccgagcagaatcagggtaacgaacgg
aactttgccatcctcaagagcctctatcactacctcgaaaatctgtga

DBGET integrated database retrieval system