KEGG   Aeromonas hydrophila pc104A: V429_10705Help
Entry
V429_10705        CDS       T03193                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp00020  Citrate cycle (TCA cycle)
ahp00190  Oxidative phosphorylation
ahp00650  Butanoate metabolism
ahp01100  Metabolic pathways
ahp01110  Biosynthesis of secondary metabolites
ahp01120  Microbial metabolism in diverse environments
ahp01130  Biosynthesis of antibiotics
ahp01200  Carbon metabolism
Module
ahp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ahp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ahp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    V429_10705 (sdhA)
   00650 Butanoate metabolism
    V429_10705 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    V429_10705 (sdhA)
Enzymes [BR:ahp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     V429_10705 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     V429_10705 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like DAO FAD_binding_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AHX69342
LinkDB All DBs
Position
2282663..2284429
Genome map
AA seq 588 aa AA seqDB search
MTIPTREFDAVVIGAGGAGMRAALQIAQSGKSCALLSKVFPTRSHTVSAQGGITVALGNA
HDDNWQWHMYDTVKGSDYIGDQEAIEYMCKTGPEAVYELENMGLPFSRFDNGTVYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNVKNKTTVFSEWYALDLVKNQDGHIVGC
TAIDMESGEVVYFKAKATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVGVQDMEFWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHIKLKLDHLGKEVLESRLPGICELSRTFAHVDPVKEPIPIIPTCHYMMGGV
PTNVNGQCLTQDKDGNDVPVVGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGMHLV
NTLSEMEHGRAASDADIDAALSRFNRWENCRDGEDPVQIRKDLQRCMQNNFSVFREGDAM
AEGLAELKLIRERLKNARLDDTSKEFNTQRIECLELDNLMETAYATAVAANFRTESRGAH
SRFDFPERDDESWLCHSLYHPDTESMTRRAVNMSPKTREAFPPKVRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgactattccaactcgtgaatttgatgcggtggtgatcggtgccggtggcgccggcatg
cgcgccgcgctgcagattgcccaatccggcaagagctgcgctctgttatccaaggtattc
ccgacccgttctcacacggtttctgcccagggcgggatcacggttgcgctgggcaatgcc
cacgacgacaactggcagtggcacatgtacgacaccgtcaagggctccgattacatcggt
gatcaggaagccattgaatatatgtgcaagaccggccccgaggccgtctatgaactggag
aacatgggcctgcccttctcccgcttcgacaacggtaccgtctatcagcgtccgtttggt
ggccagtccaagaatttcggtggcgagcaggcggcccgtaccgcggcggcagccgaccgt
accggtcacgccctgttgcacaccctctatcagcaaaacgtcaagaacaagaccaccgtc
ttctccgagtggtatgcgctggatctggtgaagaaccaggacggccacatcgttggctgt
accgccatcgacatggagagcggtgaagttgtctacttcaaggccaaggccaccgtactc
gctaccggcggtgccggtcgcatctaccagtccaccaccaacgcccacatcaacaccggt
gatggcgttggcatggcgctgcgcgccggggtcggcgtgcaggacatggagttctggcag
ttccacccgaccggcatcgccggggcaggggtgctggtgaccgaaggttgccgcggtgaa
ggcggttacctgctcaataaagacggcgagcgcttcatggagcgttatgcgccgaacgcc
aaggatctggccggtcgcgacgtggtggcccgttccataatgatcgagatccgcgaaggt
cgtggctgtgacggtccctggggcccgcacatcaagctcaagctggatcacctcggcaaa
gaggtgctggaatcccgcctgccgggcatctgcgagctctctcgcaccttcgcccacgtg
gatccggtcaaagagccgattccgattatcccgacctgccactacatgatgggcggcgtg
ccgaccaacgtgaacggccagtgcctgacccaggacaaggacggcaacgacgtgccggtg
gtcggtctgtttgcggtgggcgaaatcgcctgcgtctcggtgcacggtgccaaccgtctg
ggcggcaactcgctgctggatctggtggtatttggccgcgccgccggcatgcacctggtc
aacaccctgagcgagatggagcacggccgcgccgcctccgacgccgatatcgacgccgca
ctgtcccgcttcaatcgctgggaaaattgccgcgacggtgaagatccggtgcagatccgc
aaggacctgcagcgctgcatgcagaacaacttctccgtattccgggaaggcgatgccatg
gccgaagggctggccgagctgaaactcatccgcgagcgcctcaagaacgcccgtctggac
gacacctccaaggagttcaacacccagcgcatcgagtgcctggagctggacaacctgatg
gagacggcctatgccaccgcggtggctgccaacttccgtaccgagagccggggcgcccac
agccgcttcgatttcccggagcgtgacgatgagagctggctgtgccacagcctctatcat
ccggacaccgagtccatgacccgtcgcgctgtcaacatgtcacccaagacccgtgaggcg
ttcccgcccaaggtccggacttactga

DBGET integrated database retrieval system