KEGG   Aeromonas hydrophila pc104A: V429_11490Help
Entry
V429_11490        CDS       T03193                                 

Definition
(GenBank) aldehyde-activating protein
Organism
ahp  Aeromonas hydrophila pc104A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFA RNA_POL_M_15KD Nudix_N_2
Motif
Other DBs
NCBI-ProteinID: AHX69481
LinkDB All DBs
Position
2468082..2468480
Genome map
AA seq 132 aa AA seqDB search
MKGHCLCGGIEVLAGDHKEVGLCHCSTCRRWSGGPLFAVHCGKEVRFRGLTPVAYRSSEW
AERGFCPTCGTHLFYHLLPTDEYIVPAGLFQSESFQLASQIFIDEKPDFYELKNETPTLT
GQQVFEQFAPKP
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaagggacattgtctgtgcggcgggattgaggtcttggccggcgatcacaaggaggtg
gggttgtgccactgcagtacctgtcggcgctggtcaggcggccccctgtttgcggtgcac
tgtggcaaggaggtgcgctttcgcgggctcaccccggtggcctatcgctcctcggagtgg
gcggagcgaggattttgccccacctgcggtacccaccttttctatcacctgttgccgacg
gatgaatacatagtgccggccggcctgtttcagagcgaatccttccagctggcgagccag
atcttcatcgacgaaaagccggacttctacgagctgaaaaacgagacaccgaccctgacc
ggtcagcaggtgttcgagcagtttgcccccaagccgtga

DBGET integrated database retrieval system