KEGG   Aeromonas hydrophila pc104A: V429_11500Help
Entry
V429_11500        CDS       T03193                                 

Definition
(GenBank) diguanylate cyclase
Organism
ahp  Aeromonas hydrophila pc104A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF PAS_4 PAS_9 PAS_8 PAS GGDEF_2 PAS_7
Motif
Other DBs
NCBI-ProteinID: AHX69483
LinkDB All DBs
Position
complement(2469213..2470508)
Genome map
AA seq 431 aa AA seqDB search
MFTQGSHADIKSSLDAIGAAVAVFSLDDDDRFTLVSANDTFAQAFELDVLGSIGKRLNEM
FPRYITGSIEQPMHECVSQQTGLESELPIDTLSRTSWWRFVISPIIPEQSRITRIMVTAI
DITAKKQLEEALKMSRKRFEAVVNSAYDGIISVNSESRIELINTAACEMFGVDESYLGKR
LETLLPQRFRANHDSYFKAFSNSPINSRPMHARASVMGLRRDGSEFPLEVTIAKINLGQT
TEMTAILRDISERARLVEELKVAATTDPLTGIANRRRFDELVKLEMQRCQRFGHTMSLLL
IDIDHFKQINDTYGHQQGDQAILSLVRRVAKQLREVDMLGRWGGEEFIVLLPETSLELAW
ASAERIRLAVESQLHQLGAGTEVPLTISIGISASLGPQDTVERMVRRADTALYLAKKQGR
NCSRKALPDSP
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgttcacacagggttcccatgccgacatcaagtcgtctctcgatgccatcggtgccgcc
gttgcggtgttttccctcgacgacgacgatcgctttaccctggtctccgccaatgacacc
tttgcccaggccttcgagctggacgtgctgggcagcatcggcaagcgcctgaacgaaatg
tttccccgctacatcaccggcagcatagagcagccgatgcacgagtgcgtgagccagcaa
acggggctcgagagcgagctgcccatcgacaccctgtcgcgcaccagctggtggcggttt
gtcatctcccccatcattcccgagcagtcccgcatcactcgcatcatggtcaccgccatc
gacatcaccgccaaaaagcagctggaggaggcgctcaagatgagccgcaagcgcttcgag
gcggtggtcaactccgcctacgacggcatcatcagcgtcaacagcgagtcgcgcatcgaa
cttatcaacaccgccgcctgcgagatgttcggggtggacgagagctacctcggcaaacgg
ctggagaccctgctgccccagcgctttcgggccaaccacgacagctacttcaaggccttc
agcaactcccccatcaactcgcgccccatgcatgcccgcgcctccgtgatggggctgcgc
cgcgacggcagcgaatttccgctggaggtgaccatcgccaagatcaatctgggccagacc
accgagatgaccgccatcctgcgggatatctcggagcgggcccggctggtggaggagctc
aaggtggcggccaccacggatccccttaccgggatcgccaaccggcgccgcttcgacgag
ctggtcaagctggagatgcagcgctgtcagcgcttcggtcacaccatgagcctactgttg
atcgacatcgatcacttcaagcagatcaacgacacctatggccaccagcaaggggatcag
gccattctcagcctggtcagacgggtcgccaaacagttgcgggaggtggacatgctgggc
cgctggggcggcgaggaattcatcgtgctgctgccggaaacctcgctggagctggcctgg
gccagtgcggagcggatccgcctcgccgttgagtcgcagctgcatcaactgggcgcaggc
accgaggtgccgctcaccatcagcatcggcatcagtgccagcctgggcccgcaggatacg
gtggaacgcatggtgcgccgggccgataccgccctctatctggctaagaaacaggggcgc
aactgctcaaggaaggcactgccagactccccctga

DBGET integrated database retrieval system