KEGG   Aeromonas hydrophila pc104A: V429_11815Help
Entry
V429_11815        CDS       T03193                                 

Definition
(GenBank) cytochrome oxidase
  KO
K00407  cytochrome c oxidase cbb3-type subunit IV
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp00190  Oxidative phosphorylation
ahp01100  Metabolic pathways
ahp02020  Two-component system
Module
ahp_M00156  Cytochrome c oxidase, cbb3-type
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    V429_11815
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    V429_11815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FixQ DUF485 Gram_pos_anchor
Motif
Other DBs
NCBI-ProteinID: AHX69544
LinkDB All DBs
Position
complement(2538523..2538702)
Genome map
AA seq 59 aa AA seqDB search
MDYGTFRGLYTLLLMAIMIGIIVWAYSKRRKTSFDEAANLVFADDEQPSADNKNAGAKQ
NT seq 180 nt NT seq  +upstreamnt  +downstreamnt
atggattacggcacatttcgcggcctgtataccctgctgttgatggccatcatgatcggc
atcatcgtctgggcctacagcaagcgccgcaagacctccttcgacgaggctgccaatctg
gtttttgccgacgacgagcaacccagtgctgataacaagaacgcaggagcgaaacaataa

DBGET integrated database retrieval system