KEGG   Aeromonas hydrophila pc104A: V429_11875
Entry
V429_11875        CDS       T03193                                 

Gene name
rlmL
Definition
(GenBank) 23S rRNA methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
ahp  Aeromonas hydrophila pc104A
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ahp03009]
    V429_11875 (rlmL)
Enzymes [BR:ahp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     V429_11875 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     V429_11875 (rlmL)
Ribosome biogenesis [BR:ahp03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    V429_11875 (rlmL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_31 Methyltransf_11 MTS Methyltransf_15 N6_Mtase Pep_deformylase
Other DBs
NCBI-ProteinID: AHX69556
LinkDB
Position
2555415..2557586
AA seq 723 aa
MRHYFYGFPVSVMKEFFATCPKGLENLLAVELTNLGAEQVRETVAGVHFKGELAIGYKAC
LWSRFASRIVLVLSEFQMNDDLDLYLGAHTIPWEEHFSGTSTIAVDFTGTNPAIRNTQYG
ALKIKDAIVDRFTKRGHVRPDVDKKSPDIRIMAHLGKGKANITLDLSGPALHQRFYRQGT
GEAPLKENLAAAMIARSGWAGEPMMDPMCGSGTLLVEAAFIAADMAPALRRERFGFDRWL
QHDSELWQSLLMEAQVRAKRGMQRSEVKLFGCDADSRVLLKARDNAKAAGVAHLITFKQA
DVTALENPLPMPAVEGEARQVGMLISNPPYGERLGEFPALLEVHQALGDALRRSFQGWKV
SILSASPELLSCLRLRADKQYRLFNGALECQLRNYQIAQDSVASQKEVAQDFANRLRKNL
KTLEKWAQKENLDCYRLYDADLPEYNAAIDRYQDYLVVQEYAAPKDIPAQKTRQRLLDMV
QAAIKVTGMDGEKVILKVRERQEGKQQYQKLSEEQHRMEVQEYGARLWVNLYDYLDTGLF
LDHRQTRRMLGQMAKGKRFLNLFAYTGSATVHAGLGGASETTTVDMSRTYLNWAQDNMRL
NSLVGREHKFVQADCLKWLSEADEQYDLIFIDPPTFSNSKRMDESFDVQRDHLLLMQHLK
RLLAAGGTLVFSNNKRHFKMDLAGLEAIGLKAQNITGKTRPKDFERNQHIHNCWIITHAE
AEA
NT seq 2172 nt   +upstreamnt  +downstreamnt
atgcggcactatttttatgggttccccgtgagcgtgatgaaagaattttttgcaacctgc
cccaaagggctggaaaacctgttggccgtcgagctgaccaacctgggcgcagagcaggtc
cgtgagaccgtggctggcgtgcatttcaaaggcgaactggccattggctacaaggcctgt
ctgtggagccgtttcgcctcccgcatcgtgctggtgctgtccgaattccagatgaatgac
gacctggatctctatctgggtgctcacaccattccctgggaagagcacttctccggtact
tccaccattgccgtggactttaccggtaccaatccggccattcgcaatacccagtacggt
gccctgaagatcaaggatgccatcgtcgatcgcttcaccaagcgcggtcacgtgcgtcct
gacgtggacaagaagtcgccggatattcgcatcatggcgcacctgggcaagggcaaggcc
aatatcacgctggacttgtcaggccccgcgctgcaccagcgtttctaccgtcagggcacc
ggtgaggcgccgctcaaagagaacctggccgccgccatgattgcccgtagcggctgggcc
ggcgagcccatgatggaccccatgtgtggctccggtacgctgctggtggaagccgccttt
atcgccgccgacatggcaccggccctgcgccgtgagcgtttcgggttcgatcgctggctg
caacacgatagcgagctatggcagagcctgctgatggaggctcaggttcgggccaagcgc
ggcatgcagcggagtgaagtgaagctgtttggttgcgatgccgacagccgcgtgctgctc
aaagcccgcgacaacgctaaagccgccggcgtggcccatctcatcaccttcaaacaggcc
gatgtcaccgcgctggaaaacccgctgccgatgccggcagtggaaggggaggcccgtcag
gtcggcatgctgatctccaaccccccctatggcgagcgtcttggcgagttcccggcactg
ctggaagtgcatcaggcgctcggcgatgccctgcgtcgcagcttccagggctggaaagtc
tccattctttccgcatcccccgagctcttgagctgtctgcgtctgcgcgccgacaagcaa
taccgcctgttcaacggcgccctcgagtgtcagctgcgcaactaccagattgcacaggac
tccgttgcttcccagaaagaggtagcccaggactttgccaaccgtctgcgcaagaatctg
aagaccctggagaagtgggcacagaaagagaacctcgactgctatcgcctctacgatgcc
gatctgccggagtacaacgccgccatcgaccgttatcaggactatctggtggtgcaggag
tacgcggcgcccaaggacattcccgcccagaagactcgtcagcgtctgctcgacatggtg
caggccgccatcaaggtgaccggcatggacggcgagaaggtgatcctgaaggtgcgcgag
cgtcaggaaggcaagcagcagtaccagaagctctccgaagagcagcaccggatggaagtg
caggagtatggcgcccgtctgtgggtcaatctctatgactatctcgataccggtctgttc
ctcgaccaccgtcagacccgccgtatgctgggtcagatggccaagggcaagcgcttcctg
aacctgtttgcctacaccggcagtgccaccgtgcacgctgggttgggtggtgccagcgag
accaccacggtggacatgtcgcgcacctacctcaactgggcacaagacaacatgcgcctc
aactcgctggtgggccgagagcacaagttcgtgcaggccgactgcctgaagtggctctcc
gaggcggacgaacagtacgacctcatcttcatcgatccgcccaccttctccaactccaag
cggatggatgagagcttcgacgtgcagcgcgatcacctgctgctgatgcagcacctgaag
cggctgctggctgcgggtggcaccctggtgttctccaacaacaagcgccacttcaagatg
gatctggccggtctcgaggccatcggtctcaaggcccagaacatcaccggcaagactcga
cccaaggatttcgagcgcaaccagcatatccacaactgctggatcatcacccatgcggag
gctgaggcctga

DBGET integrated database retrieval system