KEGG   Aeromonas hydrophila pc104A: V429_13160Help
Entry
V429_13160        CDS       T03193                                 

Definition
(GenBank) methylcrotonoyl-CoA carboxylase
  KO
K01968  3-methylcrotonyl-CoA carboxylase alpha subunit [EC:6.4.1.4]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp00280  Valine, leucine and isoleucine degradation
ahp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    V429_13160
Enzymes [BR:ahp01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.4  methylcrotonoyl-CoA carboxylase
     V429_13160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Biotin_lipoyl_2 Dala_Dala_lig_C HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AHX69787
LinkDB All DBs
Position
2835948..2837912
Genome map
AA seq 654 aa AA seqDB search
MTQYHSIKRLLIANRGEIAVRIIKTARRLGIHTIALYSDADASAMHVREADEAWHLGPAP
ARESYLDTGKVLRIAQQANADAIHPGYGFLSENSDFATACEQRGVRFIGPSGAAILAMGD
KSGAKALMQAAGVPVLPGYHGADQHPDFLRDQASQVGFPLLIKAASGGGGKGMRRVDQLA
DFDDALAAVKREASAAFGDDHVLLERYLARARHVEVQVFADTLGNAIYLGDRDCSLQRRH
QKVIEEAPAPDIAPALRRAMGEAAVAAARAITYRGAGTIEFLLCGEEFFFMEMNTRLQVE
HPVTEAVTGQDLVAWQLAVADGKPLPLTQEEVVLRGHAVEARLYAEDVAAGFLPASGPIN
WLHWPAGVRIDTGVGAGDAVSPYYDPMIAKLIAHAPSRSEAFASLADALAALELGPLVHN
GPLLLRLCEEPEVLVMGHHTQWPIPTDTLPVPALAWPLAALWLASREHGASPWQQAAGFR
LGPTRSFSAAVRIGEEARVLTLAERAGSLLWQGEQIPFELGADQIRLQQAGCWQRYPLHA
LGEGDYLLQLAGRRIRFSADDQHHQLHHDHEAGDTPGILAPMHGIVVALQVEAGQPVSKG
QPLLVLEAMKMEHVLKADRDGVIEALQCRQGEQVSQGALLVRFAEQHTAQEERS
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgactcaataccactccatcaagcgcctgctgatcgccaatcgcggcgaaatcgccgtg
cgcatcatcaagacagcccggcgcctcggcattcacaccatcgccctctactcggatgcc
gatgccagcgccatgcatgtgcgggaagccgacgaagcctggcatctggggccggccccc
gcccgggagagctacctcgacaccggcaaggtgctgcgcatcgcccagcaggcgaacgcc
gacgccatccacccgggctacggtttcctgtccgaaaacagcgattttgccaccgcctgc
gagcagcggggcgtgcgcttcatcggcccaagcggcgccgccattctcgccatgggcgac
aagtcgggcgccaaggcgctgatgcaggcagccggcgtgccggtgctgcccggttatcac
ggtgcggatcagcaccccgactttttgcgcgatcaggcgagccaggtgggcttcccgctc
cttatcaaggcggccagcggcggcggtggcaagggaatgcgccgggtcgatcagctggcc
gactttgacgacgccctggcggcggtcaagcgggaggcaagcgccgccttcggtgacgac
cacgtgctgctggagcgctatctcgcccgcgcccgccacgtggaggtgcaggtgtttgcc
gataccctcggcaacgccatctatctgggggatcgggactgctcgttgcagcgccgccat
cagaaggtgatcgaggaggcccccgcccccgacatcgcaccggcgctgcgccgtgccatg
ggcgaggccgccgtcgccgctgcccgggccatcacatatcggggggccggcaccatcgag
tttctgctgtgcggggaggagttcttcttcatggagatgaacacccggctgcaggtggag
cacccggtcaccgaggccgtcaccggccaggatctggtggcctggcagctggcggtggcc
gacggcaagccgctgccgctcacccaggaggaagtggtgctgcgcggccacgcggtggag
gcgcgcctctacgccgaggatgtggcggccggttttctgcccgccagcggccccatcaat
tggcttcactggccggctggtgtgcgcatagacaccggcgtcggcgctggcgatgcggtg
agcccctattacgaccccatgatcgccaagctgatcgcccacgctccgagccgcagcgaa
gcctttgccagcctggccgacgcgctggcggcgctggaactcggccccttggtgcacaac
ggcccgctgttgctgcgcctgtgcgaagagccagaggtattggtcatgggccaccacacc
cagtggcccattcccaccgataccctgcccgttccggcgctcgcctggccgctcgccgcg
ctctggctcgccagtcgcgagcacggcgcctccccctggcagcaggccgcaggctttcgg
ctgggccccacccgcagctttagcgcagcggtgcgcatcggcgaggaggcccgcgtgctg
accctcgccgagcgggcaggcagcctgctctggcagggcgagcagatcccgttcgagctc
ggggcggatcagatccgcctgcagcaggccggctgctggcagcgctacccgctgcacgcc
ctcggcgagggcgactatctgctgcaactggcgggcaggcgcatccgcttttcggccgat
gatcagcatcatcagctgcaccatgatcacgaggcaggcgatacccccggcatcctggcc
cccatgcacggcatcgtcgtggcgttgcaggtcgaggccggccagccggtcagcaagggg
cagcccctgctggtgctggaggcgatgaagatggagcacgtcctcaaggccgatcgggat
ggggtgatcgaggcgctgcagtgccgtcagggcgaacaggtgagtcagggcgccctgctg
gtgcgctttgccgagcagcataccgcgcaggaggagcgctcatga

DBGET integrated database retrieval system