KEGG   Aeromonas hydrophila pc104A: V429_13505
Entry
V429_13505        CDS       T03193                                 

Gene name
xseA
Definition
(GenBank) exodeoxyribonuclease VII large subunit
  KO
K03601  exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    V429_13505 (xseA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_13505 (xseA)
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     V429_13505 (xseA)
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     V429_13505 (xseA)
SSDB
Motif
Pfam: Exonuc_VII_L tRNA_anti_2 tRNA_anti-codon Dip Baculo_PEP_C
Other DBs
NCBI-ProteinID: AHX69847
LinkDB
Position
2915044..2916408
AA seq 454 aa
MNYRNEPSQSRQQQVFTVTRLNSAVRMILEQDLGLVWLTGELSNLAIPSSGHWYFSLKDM
SAQVRCAMFKGNNRRVAFRPQDGMQVLVQARVSLYEPRGDYQLIIESMQPAGDGVLALRF
EELKRRLGAEGLFDEGRKRPLPREPRAVGLITSATGAALHDMLTVLKRRAPDLPVFIYPT
QVQGSAAIGQIVSAIALANRRAEVDVLIVGRGGGSLEDLWCFNEEAVARAIAHSAIPVVS
AVGHEVDVTISDFAADLRAPTPSAAAELVAPDQSARAQRLAHLKQQLLQAMSRQQTAARH
DFILLQKRLDHQDPKRRLEQQSQRLDELSARLQQLMNHKLHQGERRLANLALRLQGKSPE
RLLAAGKRRHQLAEERLHALIAKRRDLADHRLAMLSARLDGVSPLATLGRGYSITRTARG
EVISRAAQVDAGQTLVTQLAEGQLRVRVEEVHQP
NT seq 1365 nt   +upstreamnt  +downstreamnt
ttgaactaccgcaacgaaccgagtcaaagcagacaacagcaggtctttaccgtcacccgc
ctcaacagcgccgtgcgcatgatcctggagcaggatctggggctggtgtggttgaccggc
gagctctccaacctggcgataccaagctccggccactggtacttctccctcaaggacatg
tcggcccaggtgcgctgcgccatgttcaagggcaacaaccggcgggtggcgtttcgcccg
caggatggcatgcaggtgctggtgcaggcgcgggtctcgctttatgagccgcgcggcgac
taccagctgatcatcgagtcgatgcagccggcgggcgacggcgtgctggcgctgcgcttt
gaggagctcaagcgtcgcctcggtgccgaggggctgtttgacgaggggcgcaagcggccg
ctgccccgcgaaccgcgcgcggtgggcctcatcacctccgccaccggcgctgccctgcac
gacatgctgaccgtactcaaacgccgcgcgccggatctgccggtgtttatctacccgacc
caggtgcagggcagcgccgccatcggccagatcgtctctgccattgccctggccaaccgc
cgcgccgaggtggatgtgctgatcgtcggacgcggcggcgggtcgctcgaagatctctgg
tgcttcaacgaagaggcggtggcgcgcgccatcgcccactccgccatcccggtggtgagc
gcggtgggccacgaggtggatgtcaccatcagcgactttgccgccgacttgcgcgccccg
actccgtcggcggcggccgagctggtggcgccggatcagagcgcccgtgcccagcgcctc
gcccatctcaagcagcaactgctgcaggcgatgagccgccagcagaccgccgcccgccac
gatttcatcctgctgcaaaagcggctcgaccatcaggatccgaaacggcggctggagcag
caatcccagcgcctcgacgagctctccgcccgcttgcagcagctgatgaatcacaaactg
catcagggggagcggcgcctcgccaatctggcgctgcgcctgcagggcaagagcccggag
cgcttgctggccgccggtaaacgccgccaccagctggccgaggagcgcctccatgccctc
atcgccaaacgccgggatctggccgaccaccgcctcgccatgctcagcgcccgcctcgac
ggggtgagcccgctcgccaccctgggtcgcggctactccatcacccgcaccgcgcgtggt
gaagtcattagccgcgccgcccaggtggatgccggccagacgctggtcacccagcttgca
gaggggcagctgcgggtgcgggtggaagaggtccaccagccataa

KEGG   Aeromonas hydrophila pc104A: V429_18430
Entry
V429_18430        CDS       T03193                                 

Definition
(GenBank) exodeoxyribonuclease VII small subunit
  KO
K03602  exodeoxyribonuclease VII small subunit [EC:3.1.11.6]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    V429_18430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_18430
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     V429_18430
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     V429_18430
SSDB
Motif
Pfam: Exonuc_VII_S KxDL
Other DBs
NCBI-ProteinID: AHX70740
LinkDB
Position
4025883..4026134
AA seq 83 aa
MASKKIDRLSFDATLEELETIVHQLEQGSLPLEEALKQFEQGIHLVRAGQQKLEQAEQKI
QILLTQADGSEQAVPFQPEQGEE
NT seq 252 nt   +upstreamnt  +downstreamnt
atggccagtaaaaaaatcgaccgcctgagttttgatgccactctggaagagctggaaacc
atagttcatcaactggaacagggctctctgccgctggaagaggccctcaagcagtttgag
cagggcattcatctggtgcgggccggtcagcagaagctggagcaggccgagcagaagatc
cagatcctgctgactcaggccgatggcagcgagcaagcagtccccttccagccagagcaa
ggagaggagtga

DBGET integrated database retrieval system