KEGG   Aeromonas hydrophila pc104A: V429_13695
Entry
V429_13695        CDS       T03193                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    V429_13695 (recR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_13695 (recR)
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     V429_13695 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      V429_13695 (recR)
SSDB
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH Toprim_2
Other DBs
NCBI-ProteinID: AHX69883
LinkDB
Position
complement(2967700..2968302)
AA seq 200 aa
MKFSPLLDEMMKALQVLPGVGPKSAQRMAFTLLERERSGGLRLAQLLSRALTEIGHCSHC
RTFTENERCEICANPKREENGLLCVVESPADVAAIEQTGQFSGRYFVLMGHLSPLDGIGP
EELGLEILERRLKDEAISELILATNPTIEGDATAWYIADMARAAGVKVSRIAHGVPVGGE
LELVDGTTLSHSLMGRQPLN
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaaattcagcccgctgctggatgagatgatgaaagccctgcaggtgctgccgggtgtc
ggccccaagtcggcacagcgcatggcatttaccctgctcgagcgtgagcgcagcggcggc
ctgcggctggcccagctgctctctcgcgccctcaccgagattggccactgtagccactgc
cgcaccttcaccgagaacgagcgctgcgagatctgcgccaatcccaagcgcgaagagaac
ggcctgctgtgcgtggtggagagcccggcggacgtggccgccatcgagcagaccggccag
ttctccggccgctacttcgtgctgatgggccacctctcgccgctggacggcattggcccc
gaggagctggggctggagatcctggagcgacggttgaaagacgaggcgatcagcgagctt
attctggccaccaaccccaccatcgagggggacgccaccgcctggtacatcgccgacatg
gcccgtgccgccggcgtcaaggtgagccggattgcccacggggtgccggtgggtggcgag
ctggagctggtggacggcaccacgctctcccactccctgatggggcgccagcctcttaat
tga

DBGET integrated database retrieval system