KEGG   Aeromonas hydrophila pc104A: V429_14090Help
Entry
V429_14090        CDS       T03193                                 

Definition
(GenBank) 4Fe-4S ferredoxin
  KO
K18930  D-lactate dehydrogenase
Organism
ahp  Aeromonas hydrophila pc104A
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    V429_14090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD-oxidase_C FAD_binding_4 Fer4_8 Fer4_7 Fer4_17 Fer4_16 Fer4_9 CCG Fer4_10 Fer4_21 Fer4 Fer4_4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AHX69953
LinkDB All DBs
Position
complement(3056939..3059731)
Genome map
AA seq 930 aa AA seqDB search
MRWNQFDAAVLSCIPPERLVSDPDLRLAHGTDASFYRLVPERIVRLDSLDEVRFVLAVCR
ELNLPCTFRAAGTSLSGQALSDSVLITLTDSWRGHRILDEGARIALQPGVIGADANRYLA
PLGRKIGPDPASINACKLGGIAANNASGMCCGTAHNSYHTLHAMTLLLADGTVLDSGDPH
SRAAFAASRPELLSGLAALRAEVLANAELAANIRHKYRLKNTTGYAINALLDHEDPVDIL
THLMIGSEGTLGFIAEVVLDTVPEYPHKASALLVFRDAEQACLATSRLKSAPVAAVELMD
GRSLRSVAGKPGLPDFIKALDLAACALLVEVHGESKEELVDRCEQVMAMAAEFAQVASVP
FTGDGAGLWAIRKGLFPAVGAVRTTGTTVIIEDVAFPIERLAEGVAGLQQLFDRFEYGEA
IIFGHALEGNLHFVFTQGFEDPAQVTRYGAFMDAVAELVAVRFGGSLKAEHGTGRNMAPY
VELEWGSEGMALMRRIKALLDPDGLLNPGVIINDDPKAHLAHLKPMPASDAIVDPCIECG
FCEAVCPSRTLSLSPRQRIVLYRELARRNRADEPSNQLSRLFDYQGIDTCAATGLCADRC
PVGINTGSLVKKLRSEKYRRFVPIARWSADHFAGVTRTARGALGLKRIAGKLLGDKALAG
LVNGVRHLSGQRTPAWLPTLPGPSRYQWLQGEGSHGGSSERAVVYLPSCASRVFGQQEDA
PSLPDVVLSLLKKAGCRVIVPQGIEGLCCGMPYDSKGMVEVAAAKRTELAEVLWQASEQG
RWPVLLDTSPCVQRLLSGALGKDLRVFEPSAFVLEHLLPHLELTPIDETVMLHITCSSRR
MGLGEKMMAVARACAREVIVPEHIQCCGFAGDKGLMTPELNAAALASLPAQVSSDCRQGF
SNSRTCEMGLSQHAGIPYHSILYLVDQAAQ
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggaaccagtttgacgccgccgtgctctcgtgcatcccgccggagcggctggtg
agcgacccggatcttcggctggcccacggcacggacgccagcttctaccggctggtgccc
gagcgcatcgtgcgcctcgactccctcgatgaggtgcgctttgtgctggcggtgtgccgc
gaattgaacctgccgtgcacctttcgcgccgccggcaccagcctctcgggccaggccctg
agcgattcggtgctcatcaccctgaccgacagctggcgcggccaccgcattctggacgag
ggggcgcgcattgccctgcaacccggggtgatcggcgccgatgccaaccgctatctggcg
cctctggggcgcaagattggaccggatcccgcctccatcaacgcctgcaagcttggcggc
atcgccgccaacaacgcgagcggcatgtgctgcggcaccgcccacaacagctatcacacc
ctgcatgccatgaccctgctgctggccgatggcaccgtgctggacagtggcgatccccac
agccgcgccgcctttgcggccagccgcccggagctgctctcggggctcgccgccctgcgc
gccgaggtgctggcgaatgccgagcttgccgccaacattcgccacaagtaccggctcaag
aacaccaccggctacgccatcaacgccctgctcgaccatgaggaccccgtcgatatcctc
acccacctgatgatcggctcggaggggaccctcggctttatcgccgaggtggtgctcgat
accgtgcccgaatacccccacaaggcctcggccctgctggtgtttcgggacgccgagcag
gcgtgtctggccacctcgcgcctgaaaagtgcgccggtggcggcggtggagctgatggat
ggacgctcccttcgctcggtggcgggcaagcccggtctgccggattttatcaaggcgctg
gatctggctgcctgcgccttgcttgtcgaggtgcatggggagtcgaaagaggagctggtg
gatcgctgcgagcaggtgatggccatggccgccgagtttgctcaggtcgcctctgtgccc
tttaccggcgacggcgccgggctctgggccattcgcaaggggctcttcccggcggtgggg
gcggtgcgcaccaccggcaccaccgtcatcatcgaggatgtcgcctttcccatcgagcgt
ctggccgaaggggtggcggggctgcagcaactgttcgatcgcttcgaatacggtgaagcc
atcatcttcggccacgcgctggagggaaacctgcacttcgtctttacccaggggttcgag
gatccggcccaggtgacccgctacggcgcctttatggatgcggtggccgaactggtcgcg
gtgcgctttggcgggtcgctcaaggccgaacacggcaccggccgcaacatggccccctat
gtggagctcgaatgggggtcggaggggatggcgctgatgcgccgcatcaaggcgctgctg
gaccccgatggcctgctcaatcccggcgtcatcatcaatgacgaccccaaggcccacctg
gcccatctcaagcccatgccggcaagcgatgccatcgtcgatccgtgcatcgaatgcggc
ttttgcgaggcggtctgcccctcgcgcaccctgtcgctctcgccgcgccagcgcatcgtg
ctctatcgcgaactggcccgccgcaatcgtgccgatgagccctccaaccagctgagccgg
ctgtttgactatcagggcattgacacctgcgcagccaccgggctctgcgccgatcgctgt
ccggtcggcatcaacaccggcagtctggtcaagaagttgcgcagcgaaaagtaccggcgc
ttcgtgcccatcgcccgttggagcgccgatcacttcgccggcgtcacccgcacggctcgc
ggggccctcggcctcaaaaggattgccggcaagctgctgggggacaaggcgctggccgga
ttggtgaacggggttcgccatctgagcggccagcgcacaccggcctggctgccgaccctg
ccggggccgagccgctaccagtggttgcaaggggagggaagccatggcggatccagcgag
cgcgctgtggtctatctgccatcgtgcgccagccgggtattcggccagcaggaggatgcc
ccgtcactgccggacgtggtgttatccctgctcaagaaggcgggctgccgggtgatagtg
ccgcaaggcattgaggggctctgctgcggcatgccctatgacagcaaggggatggtcgag
gtggcagccgccaagcgtactgagctggccgaggtattgtggcaggcaagcgagcagggg
cgctggcccgtgctgctcgacaccagcccctgcgtgcagcggctgctttcaggggcgctc
ggcaaggacctgcgggtgttcgagccctccgcctttgtgctggaacacctgctgccccac
cttgagctgacccccatcgatgagaccgtcatgctccatatcacctgcagcagccggcgt
atggggctgggggagaagatgatggcggtggcccgcgcctgtgcccgcgaggtgatcgtg
cctgagcatatccagtgctgcggctttgccggcgacaaggggctgatgaccccggagctc
aacgccgccgcgctcgccagcctgcccgcccaggtgtccagcgattgccgtcagggattc
agcaacagccgcacctgcgaaatggggcttagccagcacgccggcatcccctatcacagc
atcctctatctggtggatcaggcggcgcagtaa

DBGET integrated database retrieval system