KEGG   Aeromonas hydrophila pc104A: V429_14455Help
Entry
V429_14455        CDS       T03193                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp00220  Arginine biosynthesis
ahp00250  Alanine, aspartate and glutamate metabolism
ahp00290  Valine, leucine and isoleucine biosynthesis
ahp01100  Metabolic pathways
ahp01110  Biosynthesis of secondary metabolites
ahp01130  Biosynthesis of antibiotics
ahp01210  2-Oxocarboxylic acid metabolism
ahp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    V429_14455
   00290 Valine, leucine and isoleucine biosynthesis
    V429_14455
   00220 Arginine biosynthesis
    V429_14455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ahp01007]
    V429_14455
Enzymes [BR:ahp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     V429_14455
    2.6.1.66  valine---pyruvate transaminase
     V429_14455
Amino acid related enzymes [BR:ahp01007]
 Aminotransferase (transaminase)
  Class I
   V429_14455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AHX70025
LinkDB All DBs
Position
3138595..3139809
Genome map
AA seq 404 aa AA seqDB search
MFTIDKSHKLDDVCYDIRGPVHKEARRLEDEGHRIIKLNIGNPAPFGFDAPEEIIKDVIL
NMPLSQGYCDSKGLFSARKAVMQYYQQKGMRKVDIDDIYIGNGASELIVMAMQALLNNGD
EMLVPSPDYPLWTAAVTLSGGHAVHYRCDEGADWYPDLDDIRARITPRTRGLVLINPNNP
TGAVYGSEFLLEVIEIARQHNLIIFADEIYDKILYDDISHTSVCTLCDDVMVVTFNGLSK
AYRACGFRQGWMVITGPKGRAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLRRQRDKAWELLNDIPGVSCVKPKGALYMFPRLDPKVYDIRDDQKMVFDLLQQEK
LLLVQGTGFNWPAPDHFRLVFLPREEELEEAIGRLARFLKGYKQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttcactatcgacaagtcgcacaagctcgacgatgtctgctatgacatccgcggcccg
gtgcataaagaagctcgccgtctcgaagacgaaggccaccgcatcatcaagctcaacatc
ggcaacccggccccgttcggtttcgatgcgccggaagagatcatcaaggatgtgatcctc
aacatgccgctcagccagggctactgcgactccaaggggctgttctcggcccgcaaggcg
gtgatgcagtactaccagcagaaagggatgcgcaaggtcgacatcgacgacatctacatc
ggcaacggcgccagcgagctcatcgtgatggcgatgcaggcgctgctcaacaacggcgac
gagatgctggtgccctcccccgactatccgctttggactgcggcagtgaccctctccggc
ggccatgcggtgcactatcgctgcgacgaaggggccgactggtacccggatctcgacgac
atccgtgcccgcatcaccccgcgcacccgcggcctggtgctgatcaaccccaacaacccc
accggcgccgtctacggcagcgagttcctgctggaagtgatcgagatcgcccgccagcac
aacctcatcatcttcgccgacgagatctacgacaagatcctctacgacgacatctcccac
accagcgtctgcaccctgtgcgacgatgtcatggtggtgaccttcaacggcctctccaag
gcctaccgtgcctgtggcttccgccagggctggatggtcatcaccggtcccaagggccgt
gccaagggctacatcgaggggctggagatgctggcctccatgcggctctgtgccaacgta
ccgatgcagcacgccatccagaccgccctgggtggctatcagagcatcaacgagctgatc
ctgccgggcggccgcctgcgccgccagcgcgacaaggcgtgggagctgctcaacgacatc
cctggggtctcctgcgtcaagcccaagggggcgctctacatgttcccgcgcctcgacccc
aaggtgtatgacatccgcgacgaccagaagatggtgttcgatctgctgcagcaggaaaaa
ttgctgctggtgcagggcaccggcttcaactggccggcgccggatcacttccggctggtg
ttcctgccccgggaagaggagctggaagaggccatcggccgtctcgcccgcttcctcaag
ggctacaagcagtaa

DBGET integrated database retrieval system