KEGG   Aeromonas hydrophila pc104A: V429_16915Help
Entry
V429_16915        CDS       T03193                                 

Definition
(GenBank) TorR family transcriptional regulator
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    V429_16915
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ahp02022]
    V429_16915
Two-component system [BR:ahp02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   V429_16915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AHX70468
LinkDB All DBs
Position
3697223..3697942
Genome map
AA seq 239 aa AA seqDB search
MQTPHILIVEDELVTRNTLKSIFEAEGYIVLEANNGDEMHQALTSHTINLVIMDINLPGK
NGLLLARELREDDNIALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR
TMNVAAGGEEKKLVERYLFNGWALDINSRALVSPAGDMFKLPRSEFRAMLHFCENPGQIQ
TRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESVNDTPEIIATIHGEGYRFCGELEQE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaccacacattctgatcgtcgaagacgaactggtcactcgcaataccctgaaa
agcatcttcgaggcagagggctatatcgtgctcgaagccaacaatggcgacgagatgcat
caggctctgacttcccacaccatcaatctggtgatcatggacatcaacctgccgggcaag
aatggcctgctgctggcacgcgagctgcgtgaggacgacaacatcgccctgatgttcctg
accggtcgtgacaacgaagtggacaagatcctgggtctggagatcggtgccgacgattac
atcaccaaaccgttcaacccccgtgagctgaccatccgtgcccgcaacctgctgagccgc
accatgaacgtggcagccggtggcgaagagaagaagctggtggagcgttacctgttcaac
ggctgggcactggacatcaacagccgcgccctggtcagcccggctggcgacatgttcaag
ctgccgcgctccgagttccgcgccatgctgcacttctgcgaaaacccgggccagatccag
acccgcgccgagctgctcaagaagatgaccggccgtgagctcaagccccacgaccgtacc
gtggatgtcaccatccgccgcatccgcaagcacttcgagagcgtcaacgacacccccgag
atcatcgccaccatccacggcgaaggctatcgcttctgcggcgagctggagcaggagtaa

DBGET integrated database retrieval system