KEGG   Aeromonas hydrophila pc104A: V429_17500
Entry
V429_17500        CDS       T03193                                 

Definition
(GenBank) Holliday junction resolvase
  KO
K07447  putative holliday junction resolvase [EC:3.1.-.-]
Organism
ahp  Aeromonas hydrophila pc104A
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    V429_17500
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     V429_17500
SSDB
Motif
Pfam: RuvX
Other DBs
NCBI-ProteinID: AHX70572
LinkDB
Position
3833567..3833989
AA seq 140 aa
MSSRSIMGFDYGTKSIGVAIGQELTGTAQPLRAIKANDGIPNWDDIDKLLKEWQPDLLVV
GLPLNMDGTEQEITVRARKFGNRLHGRFGKQVEFKDERLTTTDARARLFERGGYRALEKG
SVDGVSAQLILEAWMEEQYS
NT seq 423 nt   +upstreamnt  +downstreamnt
atgtcatcacgcagtatcatgggctttgactacggcaccaaaagcataggggtggccatc
ggtcaggagcttaccggcacggcccagcccctgcgcgccatcaaggccaacgacggcatc
cccaactgggacgacatcgacaagctgctcaaggagtggcaaccggatctgctggttgtc
ggcctgccactcaacatggacggcaccgagcaggagatcacggtacgggcccgcaaattc
ggcaaccggctgcacggccgcttcggcaaacaggtggagttcaaggacgagcggctcacc
accacggatgcacgggcacgtctgttcgagcgggggggttatcgggcgctggagaaaggc
agtgtggacggagtctccgcccagctgatcctggaagcctggatggaagagcagtacagt
tga

DBGET integrated database retrieval system