KEGG   Aeromonas hydrophila pc104A: V429_17770
Entry
V429_17770        CDS       T03193                                 

Definition
(GenBank) DNA adenine methylase
  KO
K06223  DNA adenine methylase [EC:2.1.1.72]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    V429_17770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ahp03032]
    V429_17770
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_17770
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ahp02048]
    V429_17770
Enzymes [BR:ahp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     V429_17770
DNA replication proteins [BR:ahp03032]
 Prokaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    V429_17770
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     V429_17770
Prokaryotic defense system [BR:ahp02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    V429_17770
SSDB
Motif
Pfam: MethyltransfD12
Other DBs
NCBI-ProteinID: AHX70617
LinkDB
Position
complement(3887605..3888477)
AA seq 290 aa
MKKTRAFLKWAGGKYSLVEEIAERLPAGRVLLEPFVGAGSVFLNTDYDAYVLNDINPDLI
GLYNHLKLTPDRFIAESRKLFVTEHNHKAAYYRLRTQFNQTDTSFERALLFLFLNRHGFN
GLCRYNKKGGFNVPFGSYKKPYFPEKELWAFAEKAQKATFICESYADAIQRAEEDWVIYC
DPPYAPLSTTASFTTYSAGGFTLDDQAVLARLARHTAARKGVPVLISNHDIELTRELYRG
ARLDEILVKRTISRNGGTRNKVAELLALYPPGIEPEQGYYPSDAELAPLG
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaaaaaaacacgcgcttttttaaaatgggccgggggaaaatactccctggttgaagag
attgccgagcgtttgccggccgggcgtgtgttgctggagcccttcgtcggggccgggtcc
gtgtttctcaacaccgactacgacgcctatgtgctcaacgacatcaatccggatctgatc
ggtctttacaatcatctcaagttgacgccggatcggttcatcgctgagtcgcgcaagctg
ttcgtgaccgagcacaaccacaaggcggcctactaccggctgcgcacccagttcaaccag
accgacaccagcttcgagcgtgccctgctgttcttgtttctgaatcgacacggtttcaat
ggcctgtgccggtacaacaagaaagggggcttcaacgtcccgttcggttcctacaagaag
ccctatttcccggaaaaagagctgtgggccttcgccgagaaggcgcagaaggcgaccttc
atctgtgaaagctatgccgatgccatccagcgcgccgaagaggattgggtgatctattgc
gatcccccctatgcgccgctctccactaccgcgagcttcaccacctattcggccggtggc
ttcaccctggatgatcaggccgtgctggccaggctggcccgccacaccgcggcgcgcaaa
ggggtgcccgtgctcatcagcaaccacgacatcgagctgacccgcgagctttatcgcggc
gcccgtctcgacgaaatcctggtcaagcgtaccatcagccgcaacggcggcacccgcaac
aaggtggccgagttgctggcgctctatccgcccggcatcgagccggagcagggctactac
ccgagcgacgccgaactggcgccactcggctga

DBGET integrated database retrieval system