KEGG   Aeromonas hydrophila pc104A: V429_18185
Entry
V429_18185        CDS       T03193                                 

Definition
(GenBank) ssDNA exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03410  Base excision repair
ahp03430  Mismatch repair
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    V429_18185
   03430 Mismatch repair
    V429_18185
   03440 Homologous recombination
    V429_18185
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_18185
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     V429_18185
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     V429_18185
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     V429_18185
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      V429_18185
SSDB
Motif
Pfam: DHHA1 RecJ_OB DHH
Other DBs
NCBI-ProteinID: AHX70696
LinkDB
Position
complement(3972511..3974241)
AA seq 576 aa
MPLQIRRRPRVDDSHLPATLHPLLRQIFASRGVEDPALLERSASQLLPPQRLFGMAQAVP
LLAEALTAQKRILIVGDFDCDGATSSALCVLALRAMGGRHIDFLVPNRFEFGYGLTPEIV
ELAVARGAEFLITVDNGISSIAGVAAAKAAGMQVLVTDHHLPGQELPDADAIVNPNQHGC
DFPSKSLAGVGVAFYLMAALNTQLRQSGWYERQGLRAPNVADYLDLVALGTVADVVALDG
NNRILVHQGLQRIRAGRCRPGIQALVDVSGRDGRRLCAADLGFALGPRLNAVGRLDDMSL
GVACLLSEDINLARQLASEMDSLNQERKEIEQGMQQEALATLEQIRFRDGEVPSGIVLHR
DEWHQGVVGLVASKVKEKYYRPVIAFAESSETELKGSGRSIPGVHLRDALELLDTRHPGL
MGKFGGHAMAAGLTLPKANIEAFGRAFEAVISELVTPELLTGVLLTDGELLPDELSLELA
ELIRASGPWGQAFPEPLFDGEFVLVQQRLVGEKHLKMMLTTDSGHAVDAIAFGVDLQRWP
DASVKRVRLVYRLDVNEWRGNRSVQLLVEHLEAAGL
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgcccctgcaaatccgtcgtcgtccgcgagttgatgattcccatctgcccgccaccctg
cacccgctgcttcgtcaaatcttcgccagccgcggggtcgaagatcccgctctgctggag
cgcagcgccagccagctgctgccgcctcagcgtctgttcggcatggcgcaggcggtgccg
ctgctggccgaggcgctgacggcgcaaaaacgcattctcatcgtcggtgattttgactgc
gacggcgccaccagctcggccctgtgcgtgctggccctgcgcgccatgggcggtcgccac
atcgatttcctggtgcccaaccgcttcgagttcggttatggcctcaccccggagatcgtc
gagctggcggtggcccgtggcgccgagttcctgatcacggtggacaacggcatctccagc
atcgccggggtggcggcggccaaggcggccggcatgcaggtactggttaccgatcaccat
ttgccgggccaggagctgcctgacgccgatgcgatagtgaatcccaaccagcatggctgc
gactttccctccaagtcgctggccggggtcggggtcgccttctatctgatggcggccctc
aacacccagctgcgccagagcggctggtatgagcgccaggggttgcgcgcgcccaacgtg
gcggattatctcgatctggtggcgctcggcaccgtggccgacgtggtggcgctggatggc
aacaaccgcatcctggtccatcagggtttgcagcggatccgggccggccgttgccgtccc
ggcatccaggcgctggtggacgtgtcgggtcgtgacggtcgtcgcctgtgcgccgccgat
ctcggctttgcgctggggccgcgcctcaacgcggtgggccggctcgacgacatgtcgctc
ggggtcgcctgcctgctgagcgaggacatcaacctggcgcgccagctcgcctccgaaatg
gacagcctcaaccaggagcgcaaggaaatcgagcaggggatgcagcaggaggcgctcgcc
accctggagcagatccgttttcgtgacggcgaggtgccatccggcatagtgctgcaccgg
gacgagtggcatcagggggtggtggggctggtggcctccaaggtgaaagagaagtactac
cgcccggtcatcgcctttgccgagagcagcgagaccgagctcaagggctccgggcgctcc
atcccgggggtgcacctgcgcgatgcgctggaactgctcgacacccgccaccccggcttg
atgggcaagtttggcggccacgccatggcggctggactgaccctgcccaaggccaatatc
gaggccttcggccgggccttcgaggcggtgatcagtgagctggtgacgcctgagctgttg
accggggtgctgctcaccgatggcgagctgctgcccgatgaactgagtctggagctggcg
gagctgatccgcgcctccggcccctggggtcaggccttccccgagccgctgtttgacggc
gaattcgtgctggtgcagcagcggctggtgggggagaagcacctcaagatgatgctgacc
acggattccggccacgcggtggatgccatcgcctttggcgtcgacttgcagcgctggccc
gatgcctcggtgaagcgggtgcgactggtctatcggctcgacgtcaacgagtggcgcggc
aaccgcagcgtgcagctgctggtggagcatctggaggccgccggcctctga

DBGET integrated database retrieval system