KEGG   Aeromonas hydrophila pc104A: V429_18460Help
Entry
V429_18460        CDS       T03193                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    V429_18460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ahp02000]
    V429_18460
Transporters [BR:ahp02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    V429_18460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 oligo_HPY SMC_N AAA_29 AAA_22 AAA_16 AAA_23 RsgA_GTPase TniB MMR_HSR1 Mg_chelatase APS_kinase AAA_27 G-alpha
Motif
Other DBs
NCBI-ProteinID: AHX70746
LinkDB All DBs
Position
complement(4032635..4034359)
Genome map
AA seq 574 aa AA seqDB search
MSLLEVKNLRIEYPSRYGVLAAVKDLSFSVEKGEIVGVVGESGAGKSTIGNAVIDLLSPP
GRIARGDIYLNGELISGKSQNEMRAIRGSRIGFIFQDPMTSLNPLFTVERQLVETILANT
DLTREAAFAKALSLMAAVGIPQPELRIKQYPHQFSGGMRQRVVIAIALSGDPELIIADEP
TTALDVSIQDQILQLIRNLCKERQVGCMLVTHDMGVVSNVTDKVAVMYRGDLVEFGTTEQ
VLGRPNHPYTRSLISAVPRSDVKLVRFPLVSYIEDAGAADTSIDLKTHWLGQSQDERAYE
GALLRVENVDLKFVTKDSLFPSRRQYVRACNNISFEIFEGETFGLVGESGSGKSTIARAI
TGLYPPDTGKIFFEGIDLTALKGEHERRPLRRQMQMVFQNPYSSMNPRMKVRDIIAEPIR
FHKLAGSESQIEGIVGDLLDHVGLGRGAGVKYPHEFSGGQRQRISIARALATRPRFLICD
EPTSALDVSVQAQILNLLKDLQQELGLTMLFISHDLPVIRQMCDRIGVMQHGHLVEVAET
EKLFTNAEHEYSRKLISLMPEFKGMSREGLEIAS
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgctcgaagtgaaaaacttgcggatcgagtacccctcccgctacggggtgctg
gccgcagtgaaggatctctctttttccgtggaaaagggggagatagtcggtgtggtaggc
gagtccggtgccggcaagtccaccataggcaacgccgtcatcgacctgctgagcccccct
ggccgtatcgcccgtggcgacatctatctcaatggcgaactcatctccggcaagagccag
aacgagatgcgggccattcgagggtcgcgcatcggcttcatcttccaggaccccatgacc
tccctcaacccgctgttcaccgtcgaacggcagctggttgaaaccattctggccaatacc
gacctcacccgtgaggcggcctttgccaaggcgctttccctgatggcggcggtggggatc
ccgcagcctgagctgcgtatcaagcagtatcctcaccagttctccggtggcatgcgccag
cgggtggtgattgccatcgccctctccggcgaccccgagctcatcatcgccgacgagccg
accacggcgctggacgtctccatccaggatcagatccttcagctcatccgcaacctctgc
aaagagcggcaggtgggctgcatgctggtgactcatgacatgggcgtggtgtccaacgtc
accgacaaggtggcggtcatgtatcgtggcgatctggtggagttcggtaccaccgaacag
gtgctgggccgccccaaccatccctatacccgcagcctcatctcggcggtaccccgctcg
gatgtgaagctggtgcgcttcccgctggtctcctatatcgaggacgccggtgcggcggat
accagcatcgatctcaagacccactggctcggccagagtcaggacgagcgcgcctatgaa
ggggcgctgctgcgggtggagaacgtggatctgaagttcgtcaccaaggactccctgttc
ccgagccgccgtcagtacgtgcgggcttgcaacaacatcagcttcgagatcttcgagggt
gaaaccttcggtctggtgggagagtctggctccggcaagtcgaccatcgcccgtgccatc
accggcctctatccgcccgataccggcaagatcttcttcgaggggatcgatctgaccgcg
ctcaagggtgagcatgagcgccgccccctgcgtcgccagatgcagatggtgttccagaac
ccctactcctcgatgaacccgcgcatgaaggtgcgcgacatcatcgccgagccgatccgc
tttcataagctggccggcagcgagagccagatcgaggggatcgtgggggatctgctggat
cacgtcggcctcggccgcggtgccggggtcaagtatccccacgaattttccggcggccag
cgtcagcgcatctccattgcccgcgctctggcgacccggccacgcttcctcatctgcgac
gagcccacctcggcgctggatgtgtcggtgcaggcccagatcctcaacctgctcaaggat
ctgcagcaggagcttggcctcaccatgctgttcatcagtcacgatctgccggtgatccgc
cagatgtgcgatcgcatcggggtgatgcagcacggtcatctggtggaagtggcggagacc
gagaaactctttaccaatgccgagcatgagtacagccgcaagctgatctccctcatgccg
gagttcaagggaatgtcccgcgaggggctggaaatcgcaagctag

DBGET integrated database retrieval system