KEGG   Aeromonas hydrophila pc104A: V429_18585Help
Entry
V429_18585        CDS       T03193                                 

Definition
(GenBank) acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp00061  Fatty acid biosynthesis
ahp00620  Pyruvate metabolism
ahp00640  Propanoate metabolism
ahp01100  Metabolic pathways
ahp01110  Biosynthesis of secondary metabolites
ahp01120  Microbial metabolism in diverse environments
ahp01200  Carbon metabolism
ahp01212  Fatty acid metabolism
Module
ahp_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    V429_18585
   00640 Propanoate metabolism
    V429_18585
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    V429_18585
Enzymes [BR:ahp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     V429_18585
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     V429_18585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp_3 ATP-grasp ATP-grasp_4 GARS_A DUF3182
Motif
Other DBs
NCBI-ProteinID: AHX70769
LinkDB All DBs
Position
4055235..4056575
Genome map
AA seq 446 aa AA seqDB search
MLDKVVIANRGEIALRILRACKELGIKTVAVHSTADRELKHVLLADETICIGKPASTDSY
LNVPAIIAAAEVTGAVAIHPGYGFLSENADFAEVVEKSGFIFIGPRAETIRLMGDKVSAI
EAMKKAGVPCVPGSDGPVDSDAKHNAAIAKRIGYPVIIKAAGGGGGRGMRVVRSEAELSA
AIALTKSEAGQFFKNDMVYMEKYLENPRHIEIQVLADGQGNALYLGERDCSMQRRHQKVV
EEAPAPGITEEMRKFIGERCVRACIEIGYRGAGTFEFLYENGEFYFIEMNTRIQVEHPVT
ELVTSVDLIKEQLRIAAGQPLSITQQDIRIRGHAIECRINAEDPATFMPSPGLIQRFHAP
GGLGVRWDSHIYAGYKVPPYYDSMIGKLICYGENRDVAIARMRQALDELVVEGIKTNVSL
QKEIMKDENFQHGGTNIHYLHKKLGL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgttggacaaagtagtcatcgccaaccgcggtgaaattgccctgcggatcctgcgcgcc
tgtaaagagctcgggatcaagacagtggccgttcactccaccgccgaccgggagctcaag
catgtgctgctggccgacgaaaccatctgtatcggcaagccggccagtaccgactcctac
ctcaatgtgccggccatcatcgccgccgccgaggtgaccggtgccgtcgccatccacccg
ggttacggcttcctctccgagaacgccgacttcgccgaagtggtcgagaaatccggcttc
atcttcatcggcccgcgcgccgaaaccattcgcctgatgggtgacaaggtctccgccatc
gaggcgatgaagaaagcgggcgtgccctgcgtaccgggctccgacggtccggtcgacagc
gatgccaagcacaacgcagccatcgccaagcgcattggctacccggtgatcatcaaggcc
gccggcggcggtggtggtcgcggcatgcgcgtggtccgcagtgaagccgagctgtctgcc
gccatcgcgctgaccaaatccgaagcaggccagttcttcaagaacgacatggtctacatg
gagaagtacctggagaacccgcgccacatcgagattcaggtgttggcagacggccagggc
aacgccctctacctgggcgagcgcgactgctccatgcagcgtcgccaccagaaggtggtc
gaagaggcgccggcacccggcatcaccgaagagatgcgcaagttcatcggtgagcgctgc
gtgcgcgcctgtatcgagatcggctaccgcggtgcgggcaccttcgagttcctgtacgag
aacggcgagttctatttcatcgagatgaacacccgtatccaggttgagcacccggtcacc
gagctggtcaccagcgtggatctgatcaaggagcagctgcgcattgccgccggtcagccc
ctgtcgatcacccagcaggacatccgcatccgcggccatgccatcgaatgccggatcaac
gccgaagacccggccaccttcatgccgtctccgggcctgatccagcgcttccacgcgccg
ggtggtctgggcgtacgctgggattcccacatctatgccggctacaaggtaccgccctac
tacgactccatgatcggcaagctgatctgttacggtgaaaaccgcgacgtcgccatcgcc
cgcatgcgtcaggcgctggacgagctggtggtggaagggatcaagaccaacgtctccctg
caaaaagagatcatgaaggacgaaaacttccagcacggtgggaccaacatccactacctg
cacaagaagctgggtctgtaa

DBGET integrated database retrieval system