KEGG   Aeromonas hydrophila pc104A: V429_18955
Entry
V429_18955        CDS       T03193                                 

Definition
(GenBank) fermentation/respiration switch protein
  KO
K11750  esterase FrsA [EC:3.1.-.-]
Organism
ahp  Aeromonas hydrophila pc104A
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    V429_18955
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     V429_18955
SSDB
Motif
Pfam: DUF1100 Abhydrolase_1 TPR_2
Other DBs
NCBI-ProteinID: AHX70843
LinkDB
Position
complement(4134518..4135786)
AA seq 422 aa
MDLNDDLNLTEKLFTRVKKVLETSEVSNSSPVAEQDDNVDETFIDGSMSSRWYRLLRRPT
WAWQGADPVEVEQTLACIAMGEGERTHERFLDTIKGYVPGNWVYEWSQLAGRYFNRGREL
VAQGERAAALKSLLKAVRYYSIASYPHLKNDELADQAQLLGNMAYREAGRLFKVPLKELQ
VPFRGKHIQGYLHLPTTDKPVPLVIVSGGIDSLQVDFLNFYLKCLEPNGIGMLSLDMPGI
GYAEHWPLVQDTSRLHQAVLNHLSEVAWVDHQRIAMVGFRLAGNVAARLAFIEPFKLRTV
VCIGAGVNQVFTNQEMFARCPRMMRDGLANRLGADAAQWESLRTKCQVFSLKTQGLLGTR
TSVPILSIGHKKDFICPEQDVRALASASRNGKAVVFDKQPLLEVYDEALKEMVDWLKKHL
CT
NT seq 1269 nt   +upstreamnt  +downstreamnt
ttggacttgaacgacgaccttaacctgaccgagaagctctttacccgggtaaaaaaggtg
ctggagacctcggaagtctccaactccagcccggtcgcggagcaggatgacaatgtcgac
gagaccttcatcgacggttccatgtcatcgcgctggtatcgtctgctgcgccggccgacc
tgggcctggcagggggcggacccggtcgaggtggagcagaccctggcctgcatcgccatg
ggagagggcgagcgtacccacgagcgcttcctggataccatcaagggttatgtgcccggc
aactgggtctatgagtggagccaactggccggccgctacttcaaccggggtcgcgagctg
gtggcacagggcgagcgggccgcagccctgaaaagcctgctcaaggcggtgcgttactac
tccatcgccagctatccccatctgaagaatgacgagttggcggatcaggcccagctgctc
ggcaacatggcctaccgcgaggcgggacgcctgttcaaggtgccgctcaaggagctgcag
gtgccgtttcgtggcaagcacattcagggctacctccatctgccgaccaccgacaagccg
gtgcccctcgtcatcgtcagcggcggcatcgactcgctgcaggtcgacttcctcaatttc
tatctcaagtgcctggagcccaacggcatcggcatgttgtcgctcgatatgccgggcatc
ggctatgccgagcattggccgctggtgcaggacaccagccggctgcatcaggcggtattg
aatcatctgtccgaagtagcctgggtcgatcaccagcgcatcgccatggtgggttttcgc
ctggcaggcaatgtggcggcgcggctcgccttcatcgagccgttcaaactcaggaccgtg
gtctgcatcggcgccggcgtcaatcaggtgtttaccaatcaggagatgtttgcccgctgc
ccgcgcatgatgcgggacgggctggccaaccggctgggggctgatgcggcccagtgggag
tcgctgcgtaccaagtgccaggtattttcactcaagacgcaaggattgctggggactcgc
acttccgtgccgatattgagtattggacacaagaaagattttatttgtcccgagcaggat
gtccgggcattggcgtccgccagccgtaacggcaaggcggtggtgttcgacaagcaaccc
ttgctggaggtatacgacgaggcgttgaaagagatggtcgattggctcaagaagcaccta
tgtacatga

DBGET integrated database retrieval system