KEGG   Aeromonas hydrophila pc104A: V429_19120
Entry
V429_19120        CDS       T03193                                 

Definition
(GenBank) oligoribonuclease
  KO
K13288  oligoribonuclease [EC:3.1.-.-]
Organism
ahp  Aeromonas hydrophila pc104A
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ahp03019]
    V429_19120
   03009 Ribosome biogenesis [BR:ahp03009]
    V429_19120
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     V429_19120
Messenger RNA biogenesis [BR:ahp03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     V429_19120
Ribosome biogenesis [BR:ahp03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    V429_19120
SSDB
Motif
Pfam: RNase_T DUF5051
Other DBs
NCBI-ProteinID: AHX70864
LinkDB
Position
complement(4166899..4167444)
AA seq 181 aa
MTVSAQNLVWIDMEMTGLDPEQNVVLEIATIVTDKDLNVLAEGPVIAIHQSDEELAKMDD
WNVNTHTNSGLVARVKASQHDEAKAVAETLEFIRQWVPERTSPLCGNSIGQDRRFMVKHM
SDLEAFFHYRNVDVSTIKELVRRWQPALLDQFKKNGTHQALDDIRESIAELQFYRSHVFK
I
NT seq 546 nt   +upstreamnt  +downstreamnt
atgacagtcagcgcgcagaacctggtatggatcgacatggagatgacgggtctggacccc
gaacagaatgtggtactggagatcgccaccatcgtcaccgacaaggacctgaacgtgctg
gccgaggggccggtcatcgccattcaccagagcgacgaagagctggccaagatggacgac
tggaacgtcaacacccataccaacagcggtctggtggcccgggtcaaggcgagccagcac
gatgaggcgaaagccgtcgccgagaccctcgagttcattcgccagtgggtgccggagcgt
accagcccgctgtgcggcaacagcatcggccaggatcgccgcttcatggtcaagcacatg
agcgatctggaagccttcttccactatcgcaacgtcgacgtcagcaccatcaaggagttg
gtgcgccgctggcagccggcgctgctggaccagttcaagaagaacggtacccatcaggcg
ctggacgacatccgcgaatccattgccgaactgcagttttaccgtagccacgtcttcaag
atctga

DBGET integrated database retrieval system