KEGG   Aeromonas hydrophila pc104A: V429_19320
Entry
V429_19320        CDS       T03193                                 

Definition
(GenBank) hypothetical protein
  KO
K02317  DNA replication protein DnaT
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    V429_19320
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_19320
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     V429_19320
SSDB
Motif
Pfam: DnaT
Other DBs
NCBI-ProteinID: AHX70900
LinkDB
Position
4215469..4216146
AA seq 225 aa
MTPAEYSALAHPRLSHPARSLYTLQLRRLVLENQLARLNYPELGRALAVVDPGDPSGFSF
QVNARQLTELFDELMEAGLLQVEAQNDSEHYHQCPFQLPLLTQRVRSPLPERPFQMHLQW
RPDAELPALARLCGVIDASYNEEDLGEFIAYWLGRPEVFDSQHQWMLKFIRALKTRRYTR
RKPMEAQGYQQVTQAQVEAGPSKRAQEMIEEAKRLAGQPQEPDND
NT seq 678 nt   +upstreamnt  +downstreamnt
atgacccctgccgaatacagcgccctcgcccatcccagattgtcccacccggcccgcagc
ctctataccctgcagctgcgccggctggtgctggaaaatcagctggccaggctcaactac
cccgaactcggccgggcgctggcggtggtcgacccgggcgatcccagcggcttttccttt
caggtcaatgcccgccagctgaccgagctgttcgatgagctgatggaggcgggtttgctg
caagtcgaggcgcaaaacgacagtgagcactaccatcagtgcccgttccagctgccactg
ctgacccagcgggtgcgcagcccgctgccggagcgcccgttccagatgcacctgcaatgg
cgcccggatgcagagctgccggccctcgcccgcctgtgcggggtgattgatgccagctac
aacgaagaggatctcggcgagttcatcgcctactggctggggcggcccgaggtgttcgac
tcccagcaccagtggatgctcaagttcatccgcgccctcaagacccgccgctatacccgc
cgcaagccgatggaggcgcagggctaccagcaggtgacccaggcacaagtcgaggcgggc
ccaagcaagcgggcgcaggagatgatcgaagaggccaagcggctggccggccagccgcag
gagccggataatgattga

DBGET integrated database retrieval system