KEGG   Aeromonas hydrophila pc104A: V429_19325
Entry
V429_19325        CDS       T03193                                 

Definition
(GenBank) ATPase AAA
  KO
K02315  DNA replication protein DnaC
Organism
ahp  Aeromonas hydrophila pc104A
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ahp03032]
    V429_19325
DNA replication proteins [BR:ahp03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    V429_19325
SSDB
Motif
Pfam: IstB_IS21 Bac_DnaA AAA AAA_16 AAA_5 NACHT Helicase_RecD AAA_29 AAA_22 AAA_18 APS_kinase AAA_14 ATPase_2 Sigma54_activat AAA_30 RNA_helicase TIP49 AAA_28 AAA_25 DUF4372 RuvB_N ATPase AAA_24 DUF2075 ABC_tran AAA_23
Other DBs
NCBI-ProteinID: AHX70901
LinkDB
Position
4216216..4217070
AA seq 284 aa
MTDPHDPLRQELEEIEAKRQKIAKAKQDHRVHDPELSRHVGGLLERIRRLQQETGGSQYD
YETLRKEYDAKANAEVRELQKAARQERIQKLIAQADLNPDWVFERMDAGDPALQYPIETA
RYFISGFEHWEKSGGGCMLIYGDYGTGKSTLAGAVAHELIARHQKSVIFQQWASIVDRLF
FNVIQDQEERNQYRRALEEVDLLIIDEVSANRAKMAESQSSFLGHLLRRRRNLSKSVILI
TNHNPQSLHQAIGDFAFEAIKAFNPVDIHLSGPSRRPHIGHYNG
NT seq 855 nt   +upstreamnt  +downstreamnt
atgactgacccgcacgatcccctgcgccaggagctggaagagatcgaagccaagcgccag
aagatcgccaaggccaagcaggatcatcgcgttcacgacccggaattgagtcgccacgtt
ggaggcctgctggagcgcattcgtcgccttcagcaagagaccggcggcagccagtacgac
tacgagaccctgcgcaaggagtacgacgccaaggccaacgccgaggtgcgcgagctgcag
aaggcagcgcgccaggagcggatccagaagctgatcgcccaggccgacctcaaccccgac
tgggtgtttgaacggatggatgccggcgatccggcgctgcaatatcccatcgagaccgcc
cgctacttcatcagcggtttcgagcactgggagaagagcggtggcggctgcatgctgatc
tacggtgactacggcaccggcaagtcgaccctggcgggcgccgtggcgcacgagttgatc
gcacgccaccagaagtcggtgatcttccagcagtgggcctccatcgtggacaggttgttc
ttcaacgtgatccaggatcaggaagagcgcaaccagtaccggcgcgccctggaagaggtg
gatctgctgatcatcgacgaggtctcggccaaccgcgccaagatggcggagagccagtcc
agcttcctcggccacctgctgcgccgccgtcgcaacctgtcgaaaagcgtcatcctcatc
accaaccacaatccccagagcctgcatcaggcaataggtgatttcgctttcgaagcgatc
aaggcgttcaatccggtggatatccacctgagcggccccagccgtcgcccccatatcggc
cactacaacggctga

DBGET integrated database retrieval system