KEGG   Aeromonas hydrophila pc104A: V429_20025
Entry
V429_20025        CDS       T03193                                 

Gene name
ruvB
Definition
(GenBank) ATP-dependent DNA helicase RuvB
  KO
K03551  holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    V429_20025 (ruvB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_20025 (ruvB)
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     V429_20025 (ruvB)
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     V429_20025 (ruvB)
    RecFOR pathway proteins
     V429_20025 (ruvB)
SSDB
Motif
Pfam: RuvB_N AAA_lid_4 RuvB_C AAA AAA_5 AAA_22 Mg_chelatase AAA_3 AAA_16 AAA_14 Rad17 AAA_18 NTPase_1 Bac_DnaA RNA_helicase TIP49 AAA_24 AAA_17 TsaE HTH_15 Sigma54_activ_2 NB-ARC AAA_28 IstB_IS21 ABC_tran
Other DBs
NCBI-ProteinID: AHX71026
LinkDB
Position
complement(4352731..4353741)
AA seq 336 aa
MIEADRLISASGGREEEVIDRAIRPKLLADYTGQDPVCEQMEIFIAAARQRGEALDHLLI
FGPPGLGKTTLANIVANEMGVNIKTTSGPVLEKAGDLAALLTNLEPNDVLFIDEIHRLSP
VVEEVLYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLIGATTRAGSLTSPLRDRFGIVQR
LEFYNVKDLTDIVARSARCLGLDMTEDGALEVARRSRGTPRIANRLLRRVRDFAQVKSDG
RIDGPIAARAMDMLDVDNEGFDFMDRKLLLAVIDKFLGGPVGLDNLAAAIGEEKDTIEDV
LEPYLIQQGYLQRTPRGRIATPRAYAHFGLQRPDEG
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgattgaagcggatcgtctcatctccgcctccggcgggcgagaagaggaagtcatcgat
cgggccatccggcccaagctgctggccgattacaccggtcaggatcccgtctgcgagcag
atggagatcttcatcgcggcggcgcgccagcgtggcgaggcgctcgatcacctgctgatc
ttcggcccgccggggcttggcaagaccacgctggccaacatcgtggccaacgagatgggg
gtcaacatcaagaccacttccggcccggtgctggagaaggccggcgatctggcggcgctg
ctcaccaacctcgaaccaaacgacgtgctgttcatcgacgagatccaccgcctcagtccg
gtggtggaggaggtgctctacccggcgatggaggattaccagctcgacatcatgatcggg
gaggggcccgccgcccgttccatcaagctcgatctgccccccttcaccctgatcggtgcc
acgacccgggctggctccctcaccagtccgctgcgggatcgttttggcatagtgcaacgg
ctcgagttctacaacgtcaaggatctgaccgacatcgtcgcgcgcagcgcccgctgcctc
gggctcgacatgacggaagacggtgcactggaggtggcgcgtcgttcgcgcggtacgccg
cgaattgctaaccgtttgttgcgccgggtgcgcgattttgcccaggtgaaatctgacggc
cgcatcgatggacccatagcggcccgagccatggacatgctggacgtagataatgaaggc
ttcgacttcatggaccgcaagttattgttggctgtgatagacaagtttctgggcgggccg
gtggggctcgacaacctggcggctgccatcggggaggagaaggacactatcgaggatgta
ctcgagccttatctgatccagcagggctatctgcaacgtacacccagagggcggatcgcg
acaccaagagcttatgcgcattttggcctgcaacggccagatgaagggtga

DBGET integrated database retrieval system