KEGG   Aeromonas hydrophila pc104A: V429_20550Help
Entry
V429_20550        CDS       T03193                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03030  DNA replication
ahp03430  Mismatch repair
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    V429_20550
   03430 Mismatch repair
    V429_20550
   03440 Homologous recombination
    V429_20550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ahp03032]
    V429_20550
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_20550
Enzymes [BR:ahp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     V429_20550
DNA replication proteins [BR:ahp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     V429_20550
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     V429_20550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi GlgS PP28
Motif
Other DBs
NCBI-ProteinID: AHX71122
LinkDB All DBs
Position
4442311..4442766
Genome map
AA seq 151 aa AA seqDB search
MSQVTFYLMSEQDDAQASAVERLACQLVADSWGAGQLYLLCDDEAQALRLDELLWQLPPE
RFVPHQLQGESGQAPVEIGHQPPRRRYARLINLAKQTPLFAGHFAQVVDFVPTDETQKQQ
ARERYKHYRQAGHTLEMRDQPVLAAPDPAQP
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagtgaccttttacctgatgagcgagcaggatgacgcgcaggcttcggccgtc
gaacgcctcgcctgccagctcgtagccgatagctggggcgcgggccagctctacctgctg
tgcgacgacgaagcgcaggccctgcgcctcgacgagctgctgtggcagctgccgccggag
cgcttcgtgccgcaccagttgcagggcgagagcggtcaggcaccggtggagatcggtcat
caaccaccacggcggcgctatgcccgcctcatcaatctggccaaacagacacctttgttt
gcaggacacttcgctcaagtggtagattttgtccccactgacgaaacgcaaaagcagcaa
gcccgcgagcgctacaagcactatcgccaggcaggccacaccctcgagatgagggatcag
cccgtccttgccgcaccggatccggcgcagccctga

DBGET integrated database retrieval system