KEGG   Aeromonas hydrophila pc104A: V429_20625
Entry
V429_20625        CDS       T03193                                 

Definition
(GenBank) recombinase RecA
  KO
K03553  recombination protein RecA
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    V429_20625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_20625
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     V429_20625
    RecFOR pathway proteins
     V429_20625
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    V429_20625
SSDB
Motif
Pfam: RecA Rad51 ATPase ATPase_2 AAA_24 AAA AAA_35 MobB AAA_25 AAA_14 TK AAA_16 CobU AAA_22 CLP1_P PAXNEB
Other DBs
NCBI-ProteinID: AHX71131
LinkDB
Position
complement(4455230..4456294)
AA seq 354 aa
MDQNKQKALAAALGQIEKQFGKGSIMRLGDSKTMDIEAISTGSLSLDVALGIGGLPCGRI
VEIYGPESSGKTTLTLQVIAEAQKKGKTCAFVDAEHALDPIYAAKLGVNVDDLLISQPDT
GEQALEICDMLVRSNAVDVIIVDSVAALTPKAEIEGEMGDSHVGLQARLMSQALRKLTAN
IKNANCLCIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGAIKEGDEVVGNE
TRVKVVKNKVAPPFKQAEFQIFYGAGISKEGELVDLGVKHKLIDKAGAWYSYNGEKIGQG
KANVMKLFAENKAMAGEVEARLRELLLSGAVPVDDKAAPVEAEEFDAESEQEFE
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggatcagaacaaacagaaggcactggcggctgcgctgggtcaaatcgaaaagcagttt
ggcaaaggctccatcatgcgtctgggcgacagcaagaccatggatatcgaagccatctct
accggctccctctccctggacgtggcgctgggaatcggtggcctgccgtgcggtcgtatc
gtcgagatctatggcccggaatcttccggtaaaaccacgctgaccctgcaggtgatcgcc
gaagcgcagaagaagggcaagacctgcgccttcgtcgatgcggagcacgcactcgacccc
atctatgccgccaagctgggcgtcaacgtcgacgacttgctgatctcccagccggatacc
ggtgagcaagcgctggaaatctgcgacatgctggtgcgctccaacgccgttgacgtcatc
atcgtcgactccgtggcggccctgaccccgaaagcggaaatcgaaggtgagatgggtgat
tcccacgtcggcctgcaggctcgtctgatgtcccaggcgctgcgcaaactgaccgccaac
atcaagaacgccaactgcctgtgcatcttcatcaaccagatccggatgaagatcggcgtc
atgttcggtagcccggagaccaccacgggtggtaacgcgctgaagttctacgcctccgtt
cgtctggatatccgtcgcatcggcgccatcaaggaaggtgacgaagtggtcggtaacgag
acccgcgtcaaagtggtcaagaacaaggtggccccgcccttcaagcaggccgagttccag
attttctatggcgccggcatctccaaagagggcgagctggtggatctgggcgtcaagcac
aagctgatcgacaaggccggtgcctggtacagctacaacggcgagaagatcggtcagggc
aaggccaacgtcatgaagctgttcgccgagaacaaggcgatggctggcgaagtggaagcc
cgtctgcgcgagctgctgctctccggtgccgtacctgtcgatgacaaggctgcaccggtt
gaggcagaagagttcgatgccgaaagcgaacaagagttcgaataa

DBGET integrated database retrieval system