KEGG   Aeromonas hydrophila pc104A: V429_20630
Entry
V429_20630        CDS       T03193                                 

Definition
(GenBank) damage-inducible protein CinA
  KO
K03743  nicotinamide-nucleotide amidase [EC:3.5.1.42]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp00760  Nicotinate and nicotinamide metabolism
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    V429_20630
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.42  nicotinamide-nucleotide amidase
     V429_20630
SSDB
Motif
Pfam: CinA
Other DBs
NCBI-ProteinID: AHX71132
LinkDB
Position
complement(4456374..4456865)
AA seq 163 aa
MKLDAEIEHLAIELGKALGQRGWLAATAESCTGGGVATAITDIAGSSGWFDRGFVTYTNE
AKQQMLGVSGESLEQHGAVSEAVVLEMARGALAHSSAAISVAISGIAGPGGATPGKPVGT
VWFAWADRSGRHHSLLARFDGDRRQVRQQAVRQALSGLLALLR
NT seq 492 nt   +upstreamnt  +downstreamnt
atgaaactggacgcagagatagagcaccttgccatcgagctgggtaaggccctcggtcag
cgcggttggctggcggcaaccgccgaatcctgtactggcggcggggtggcgacggctatt
accgacatcgcgggcagctccggctggttcgatcgcggttttgtcacctacaccaacgaa
gccaagcagcagatgctgggggtgagcggcgagagccttgagcagcacggcgcggtgagc
gaagccgtggtgctggagatggcccgcggtgcgctggcccactcctctgccgccatcagt
gtcgccatcagcggcatcgccggccctggcggcgcgacaccgggcaaaccggtcggcacc
gtctggttcgcctgggcggaccgctccggccgtcatcactccctgctggcccgtttcgac
ggggatcgccggcaggtgcgccagcaggcggtgagacaggccttgtcgggtctgttggcc
ctgctcagataa

DBGET integrated database retrieval system