KEGG   Aeromonas hydrophila pc104A: V429_20650
Entry
V429_20650        CDS       T03193                                 

Definition
(GenBank) DNA mismatch repair protein MutS
  KO
K03555  DNA mismatch repair protein MutS
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    V429_20650
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ahp03400]
    V429_20650
DNA repair and recombination proteins [BR:ahp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     V429_20650
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II MutS_IV
Other DBs
NCBI-ProteinID: AHX71134
LinkDB
Position
4465729..4468305
AA seq 858 aa
MNTDENPIEIMMKQAGHTPMMQQYLTLKAENPEILLFYRMGDFYELFYDDARKASQLLDI
SLTKRGQSAGSPIPMAGVPYHAIEGYLAKLVQLGESAAICEQVGDPATSKGPVERKVIRI
ITPGTVSDEALLSERQDNLIAAVYHDGRRFGYGTMDIGSGRFFINQFEKEETLLAELQRT
NPAELLYPESFAFLHHVEGRRGLRRRPEWEFELGTARKLLCQQFGTQDLVGFGVEQSETA
LCAAGCLMQYVKDTQRTALPHIRSVRLEQPDHAVIMDAATRRNLELTQNLAGGHDNTLSA
VLDCTATPMGSRLLKRWIHQPIRDRVILKGRQSTIKELIEQNLYDELGGLLRQVGDVERV
LARLALRSARPRDLTRLRQAFAQLPELQRLLAESEHEAVQQLRDRASTFPELLALLERAV
MEVPPVLIRDGGVIRDGFNQELDELRDLANGATASLARIEERERLLTGINTLKVGYNKVH
GFYIEVSRANSHLVPAHYIRRQTLKNNERYIIDELKKYEDKVLTAQAQALALEKRLYEEL
LDALLPHLGDLQESAAALAELDVLANLAERAETLDYRCPTLIDEDQILIEAGRHPVVEQV
MTDPFIANPIHLDRDRRMLIITGPNMGGKSTYMRQTALIVLLAHIGAFVPADSARIGPID
RIFTRIGASDDLASGRSTFMVEMTETANILNNATARSLVLMDEIGRGTSTYDGLSLAWAC
AEQLASKIGAYTLFATHYFELTRLPELMKGLANVHLDAVEHGDTIAFMHAVQEGAASRSY
GLQVAALAGVPKSVIQQARHKLHELESATPVAAGESRPAPVAMAPQSHPVVDELEAVRPD
ELTPRQALDLLYRLKQML
NT seq 2577 nt   +upstreamnt  +downstreamnt
atgaatacagatgaaaacccgattgaaatcatgatgaaacaggctggtcatacaccaatg
atgcagcagtatctgaccctcaaggccgagaacccggagatcctgctgttctaccggatg
ggcgacttctacgagctgttctacgacgatgcccgcaaggcctcccagctgctcgacatc
tccctgaccaagcgcggccagtcggccggcagccccatcccgatggcaggcgttccctat
catgccatcgagggctatctggccaagctggtgcagctcggcgagtcggccgccatctgc
gaacaggtgggggatcccgccaccagcaaggggccggtggagcgcaaggtcattcgcatc
atcaccccgggcaccgtctccgacgaggcgctgctcagcgagcggcaagacaacctgatc
gccgccgtctaccacgatggccgccgcttcggctacggcaccatggacatcggctccggc
cgcttcttcatcaaccagttcgagaaagaggagaccctgctggcggaactgcagcgcacc
aatccggcggagctgctctaccccgaatccttcgccttcctgcatcacgttgaaggtcgc
cgcggtctgcgccgccgcccggagtgggaatttgagctcggtaccgcccgcaagctgttg
tgccaacagttcggcacccaggatctggtgggctttggcgtcgagcagagcgagaccgcc
ctgtgcgccgccggctgcctgatgcaatacgtgaaagacacccagcgcaccgccctgccc
cacattcgcagcgtgcgcctcgagcagcccgatcatgcggtcatcatggatgcggccacc
cgccgcaatctggagctgacccagaatctggccggcggccacgacaacaccctctccgcc
gtactggactgcaccgccacccccatgggcagccggctgctcaagcgctggatccaccag
ccgatccgcgaccgggtgatcctgaaaggtcgccagagcaccatcaaggagctcatcgag
cagaacctctatgacgagctgggcggcttgctgcgccaggtcggcgacgtggagcgggtg
ctggcgcgcctggccctgcgctcggcccgcccgcgcgacctcacccgcctgcggcaggcc
ttcgcccagttgcccgaattgcagcgtctgctggcggagagcgagcacgaggcggtgcag
cagttgcgcgatcgcgccagcaccttccccgaactgctggctctgctggagcgcgccgtg
atggaggtgccaccggtgctgatccgcgatggcggcgtcatccgcgacggcttcaaccag
gagctggacgagctgcgggatctggccaacggcgccaccgccagcctggcccgcatcgag
gagcgcgagcggctgctgaccggcatcaacaccctcaaggtgggctacaacaaggtgcac
ggcttctacatcgaggtgagccgagccaacagccacctggtgccggcccactacatccgc
cgccagactctcaagaacaacgaacgctacatcatcgacgagcttaaaaagtacgaggac
aaggtgctcaccgcccaggcccaggcgctggcgctggaaaaacgcctctacgaagagctg
ctcgatgctctgctgccgcatctgggcgatctgcaggagtccgccgccgcgctggcggag
ctggacgtgctggccaacctggccgagcgggccgagaccctcgactaccgctgcccgacg
ctcatcgacgaggatcagatcctgatcgaggcgggccgccatccggtggtggagcaggtg
atgaccgacccctttatcgccaacccgatccacctcgaccgtgatcgccgcatgctgatc
atcaccggccccaacatgggcggtaaatcgacctacatgcgccagaccgcgctgatcgtg
ctgctggcccacatcggcgccttcgtgccggccgacagcgcccgcatcggtcccatcgac
cgcatcttcacccgcatcggggcatcggatgatctggcatcgggaagatctacctttatg
gtggagatgaccgagacagccaatatcctcaacaacgccaccgcccgcagcctggtgctg
atggacgagatcggtcgcggcaccagtacctatgacggtctctcgctggcatgggcctgc
gccgaacagctggcaagcaagatcggcgcctacaccctgttcgctacccactacttcgag
ctgacccgtctgccggagctgatgaaagggctggccaacgtccacctcgatgcggtggag
cacggcgacaccatcgcctttatgcacgcggtgcaggaaggcgcagccagccgctcttac
ggtctgcaagtggcggcactggcgggggtgccgaaatcggtgatccagcaggcccgtcac
aaactgcacgagctggaaagcgctaccccggtggccgctggcgaatctcgcccggcccca
gtggccatggcgccccagagccatccggtggtcgatgagctggaagcggtgcgcccggac
gagctcaccccccgtcaggcgctggatctgctctatcgtctcaaacagatgctgtga

DBGET integrated database retrieval system