KEGG   Aeromonas hydrophila pc104A: V429_20665
Entry
V429_20665        CDS       T03193                                 

Definition
(GenBank) MarR family transcriptional regulator
Organism
ahp  Aeromonas hydrophila pc104A
SSDB
Motif
Pfam: MarR MarR_2 HTH_27 HTH_24 Replic_Relax HTH_Crp_2 PadR TrmB HxlR Penicillinase_R Spore_SspJ HTH_IclR TetR_C_35 HTH_34 HTH_1 GntR DUF2857
Other DBs
NCBI-ProteinID: AHX71137
LinkDB
Position
4470721..4471200
AA seq 159 aa
MEKHDEVLVALRQIIRAIDMHSKRLIKEAGLTSPQLLLLKGIDELGQISMRQLADHTNMS
QATATTIMDRLESRQLVQRIRSETDKRKVHATLTDAGRALLAQAPTPLQERFIQRFQALE
VWEQTLLLSSLQRISAMMNADEIDAAPVLSVRPLTEERA
NT seq 480 nt   +upstreamnt  +downstreamnt
atggaaaaacatgatgaagtgctggtcgccctgcgccagataattcgtgccatcgacatg
cactccaagcgcttgatcaaggaggccggcctgacctcgccccagctcttgctgctcaag
gggatcgacgagctgggccagatctccatgcgccagctggcggatcacaccaacatgagc
caggccaccgccaccaccatcatggaccgcctcgagagccgccagctggtgcagcgcatc
cgcagcgaaaccgacaagcgcaaggtgcatgcgacgctgactgacgcaggccgagccctg
ctggcccaggcgcccaccccgctgcaggagcgcttcatccagcgctttcaggcacttgag
gtctgggagcagaccctgttgctctcttccctgcagcgcatctcggccatgatgaatgcc
gacgagatagacgcggccccagtgctgagcgtccggcccctcaccgaagagcgggcataa

DBGET integrated database retrieval system