KEGG   Aeromonas hydrophila pc104A: V429_20735
Entry
V429_20735        CDS       T03193                                 

Definition
(GenBank) ABC transporter substrate-binding protein
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
ahp  Aeromonas hydrophila pc104A
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ahp02000]
    V429_20735
Transporters [BR:ahp02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    V429_20735
SSDB
Motif
Pfam: SBP_bac_3
Other DBs
NCBI-ProteinID: AHX71150
LinkDB
Position
complement(4483695..4484429)
AA seq 244 aa
MRAWWWLWCLLSISAHGETLRLYDYHQHPPFMTGEQTGLSRDLVKYLNEKLGGEPRLELW
LVNRARLALEMSDPGFDGLVAWVNPAWVGDPQRELYLWTFPIMRDTNELISSVARPVIYR
GPDSLKGMSFGGIEGYRYQGIDEAAARGDLVRVDAKKVKTNFSLLVRGRIDVTLVPGSAL
TFFTHDPAFEGKLFVSPFAQSSYTRHILLPKSRSALHSRLNDIAEQMDRDPKWHAILESY
RGRP
NT seq 735 nt   +upstreamnt  +downstreamnt
atgcgagcgtggtggtggttgtggtgtttgctgtcgatatcggctcatggcgagacgctg
cgtctctacgactatcatcagcacccccccttcatgaccggggagcagactggtctgagc
cgggatctggtcaagtatctcaatgaaaagcttggcggagaacccaggctggaactttgg
ctggtgaatcgggccagactggcgctggagatgtcggaccccggcttcgatggcctggtg
gcctgggtcaatcccgcctgggtgggggatccccagcgcgagctctacctctggaccttt
cccatcatgcgcgataccaacgagctcatctccagcgtcgccaggccggtcatctatcgc
gggcccgactcactgaaggggatgagcttcggcggcatcgaggggtatcgctatcagggc
atcgacgaggcggcggccaggggcgatctggtgcgggtcgatgccaagaaggtcaagacc
aacttcagcctgctggtgcgcggtcgcatcgacgtgaccctggtgccgggctcggcgctc
accttcttcacccatgacccggccttcgagggcaagctgttcgtctcgccctttgcccag
tccagctatacccgccacatcctgttgccaaaatcccgcagcgcactgcactcccggctg
aatgacatcgccgagcagatggaccgggatcccaagtggcacgccatcctggagtcctac
cgcggcagaccctga

DBGET integrated database retrieval system