KEGG   Aeromonas hydrophila pc104A: V429_20780
Entry
V429_20780        CDS       T03193                                 

Definition
(GenBank) copper-sensitivity protein C
Organism
ahp  Aeromonas hydrophila pc104A
SSDB
Motif
Pfam: DSBA Thioredoxin_4 Thioredoxin_2
Other DBs
NCBI-ProteinID: AHX71159
LinkDB
Position
4490365..4490517
AA seq 50 aa
MDLRPHRLRIGTLLGVQGTPATLIGNQLVPGAVPYDELEQLVKAELAKRS
NT seq 153 nt   +upstreamnt  +downstreamnt
atggatctgcgaccacaccgactgcgcatcggcactcttcttggcgtgcagggcaccccg
gcaacgctgatcggcaaccagctggtaccgggtgccgtgccctatgacgagctggagcaa
ctggtgaaggccgagctggccaagcggagctaa

DBGET integrated database retrieval system